IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16. Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16. J. Biol. Chem. (0021-9258) 2006 imex curation Sou YS., Tanida I., Komatsu M., Ueno T., Kominami E. BioCreative - Critical Assessment of Information Extraction systems in Biology kominami@med.juntendo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Sou YS., Tanida I., Komatsu M., Ueno T., Kominami E. BioCreative - Critical Assessment of Information Extraction systems in Biology kominami@med.juntendo.ac.jp Accepted 2006-AUG-25 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation gbrl2_human Gamma-aminobutyric acid receptor-associated protein-like 2 GABA(A) receptor-associated protein-like 2 Golgi-associated ATPase enhancer of 16 kDa General protein transport factor p16 Ganglioside expression factor 2 MAP1 light chain 3-related protein GABARAPL2 FLC3A GEF2 protein protein human Homo sapiens Human MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF DIP protein P60520 original sequence version: 93 DIP protein P60520 original sequence version: 112 17ACB540FD5B975B mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV DIP protein Q9GZQ8 original sequence version: 69 DIP protein Q9GZQ8 original sequence version: 108 DIP protein Q9GZQ8 original sequence version: 129 DIP protein Q9GZQ8 original sequence version: 132 DIP protein Q9GZQ8 original sequence version: 148 DIP protein Q9GZQ8 original sequence version: 152 DIP protein Q9GZQ8 original sequence version: 111 DIP protein Q9GZQ8 original sequence version: 153 BB141DEC7653E83F gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 atg7_human Ubiquitin-like modifier-activating enzyme ATG7 ATG12-activating enzyme E1 ATG7 Ubiquitin-activating enzyme E1-like protein ATG7 APG7L Autophagy-related protein 7 protein protein human Homo sapiens Human MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI DIP protein O95352 original sequence version: 50 DIP protein O95352 original sequence version: 138 ABBD1A29A6C58356 atg3_human Ubiquitin-like-conjugating enzyme ATG3 Autophagy-related protein 3 Protein PC3-96 ATG3 APG3 APG3L protein protein human Homo sapiens Human MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM DIP protein Q9NT62 original sequence version: 93 40EFE88DB5FE3EAB atg7-map1lc3b 1 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Figure 2 A In vitro formation of E1-substrate intermediates between Atg7 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 and LC3 interaction via a thioester bond formation atg7-gabarap 1 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Figure 2 B In vitro formation of E1-substrate intermediates between Atg7 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 and GABARAP interaction via a thioester bond formation. atg7-gabarapl2 1 5 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Figure 2 C In vitro formation of E1-substrate intermediates between Atg7 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 protein interaction with GABARAPL2 protein was proposed to be va thioester bond formation. atg3-map1lc3b 1 3 unspecified role unspecified role neutral component neutral component gly sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Figure 3 A In vitro formation of E2-substrate intermediates between Atg3 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 and LC3 interaction via a thioester bond formation atg3-gabarap 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Figure 3 B In vitro formation of E2-substrate intermediates between Atg3 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 and GABARAP interaction via a thioester bond formation. atg3-gabarapl2 1 2 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Figure 3 C In vitro formation of E2-substrate intermediates between Atg3 and the three human Atg8 homologs. Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 protein interaction with GABARAPL2 protein was proposed to be va thioester bond formation.