IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. J. Biol. Chem. (0021-9258) 2006 imex curation Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no lmei@mcg.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no please note the host organism as in text is hek293 as in fig is cos7 lmei@mcg.edu Accepted 2006-SEP-18 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. J. Biol. Chem. (0021-9258) 2006 imex curation Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no lmei@mcg.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no lmei@mcg.edu Accepted 2006-SEP-18 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex. J. Biol. Chem. (0021-9258) 2006 imex curation Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no lmei@mcg.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dai P., Xiong W.C., Mei L. BioCreative - Critical Assessment of Information Extraction systems in Biology The authors have mentioned that the interaction was carried out in human-293 cells in the text and have refered to the co-immunoprecipitation as being carried out in COS7 cells in the figure 3 no please note the host organism as in text is hek293 as in fig is cos7 lmei@mcg.edu Accepted 2006-SEP-18 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation erbin_human Erbin ERBIN Densin-180-like protein ERBB2IP Erbb2-interacting protein KIAA1225 LAP2 Protein LAP2 protein protein human Homo sapiens Human MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKMVLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNLKRYPTPYPDELKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQKISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDENFNSLLQNGDILNSSTEEKFKAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKLITNDTFQPEIMERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHDSDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVKITSAVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRGPTSGPQSAPQIYGPPQYNIQYSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTAYHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMMPGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQVLRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQMGQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS 304DFC81578CF671 shoc2_human Leucine-rich repeat protein SHOC-2 Protein soc-2 homolog SHOC2 KIAA0862 Protein sur-8 homolog protein protein human Homo sapiens Human MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV F3F828646642A855 rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein P01112 original sequence version: 91 DIP protein P01112 original sequence version: 106 DIP protein P01112 original sequence version: 144 DIP protein P01112 original sequence version: 118 DIP protein P01112 original sequence version: 143 DIP protein P01112 original sequence version: 152 DIP protein P01112-1 original sequence version: 159 DIP protein P01112 original sequence version: 170 DIP protein P01112-1 original sequence version: 185 DIP protein P01112 original sequence version: 192 DIP protein P01112-1 original sequence version: 196 DIP protein P01112-1 original sequence version: 202 EE6DC2D933E2856A shoc2-erbb2ip 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined lrr region sufficient to bind sufficient binding region sufficient to bind range range range range lrr region required to bind necessary binding region required to bind range range range range physical association physical association The Sur-8 human was used in this interaction since there is 100% identity between human and mouse (the only other sequenced Sur-8) and the authors have used human protein before in their lab. 3A, 3B results suggest that Erbin interacts with Sur-8 in cells. Further analyses showed that Erbin interaction with Sur-8 requires the LRR domain. shoc2-erbb2ip-1 1 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The Sur-8 human was used in this interaction since there is 100% identity between human and mouse (the only other sequenced Sur-8) and the authors have used human protein before in their lab. 3A Erbin bound to Sur-8 and inhibited the interaction of Sur-8 with Ras and Raf shoc2-erbb2ip-2 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association The Sur-8 human was used in this interaction since there is 100% identity between human and mouse (the only other sequenced Sur-8) and the authors have used human protein before in their lab. 3C Erbin was detected in Sur-8 precipitates, suggesting that endogenous Erbin and Sur-8 may interact in cells. shoc2-erbb2ip-3 2 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association The Sur-8 human was used in this interaction since there is 100% identity between human and mouse (the only other sequenced Sur-8) and the authors have used human protein before in their lab. 4 Sur-8 and RasV12 co-precipitated Decreased interaction between Ras and Sur-8 was observed in the presence of Erbin.