IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. J. Biol. Chem. (0021-9258) 2006 imex curation Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions mouse-att_20 Mus musculus att_20 Mouse pituitary tumour anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology The source of the casein kinase II was not described therefore the relevant phosphorylation experiment was not included. Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu Accepted 2006-AUG-29 by JYOTI. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. J. Biol. Chem. (0021-9258) 2006 imex curation Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions rat-rin_5f Rattus norvegicus rin_5f Rat islet cell tumour anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu Accepted 2006-AUG-29 by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation nec2_rat Neuroendocrine convertase 2 Prohormone convertase 2 Proprotein convertase 2 KEX2-like endoprotease 2 Pcsk2 Nec2 Nec-2 Rpc2 protein protein rat Rattus norvegicus (Rat) Rat MEGGCGSQWKAAGLLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN 45DCB85B2CDA4B19 7b2_rat Neuroendocrine protein 7B2 Secretory granule endocrine protein I Secretogranin-5 Secretogranin V Scg5 Sgne1 protein protein rat Rattus norvegicus (Rat) Rat MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE 14FBA7D070E79992 scg5-pcsk2 2 4 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2A Phosphorylated 7B2 fails to interact with pro-PC2. The authors concluded that non-phosphorylated 7B2 protein coimmunoprecipitated with PC2 protein. pcsk2-scg5 2 3 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2A Phosphorylated 7B2 fails to interact with pro-PC2. scg5-pcsk2-1 1 4 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2A Phosphorylated 7B2 fails to interact with pro-PC2. The authors concluded that non-phosphorylated 7B2 protein coimmunoprecipitated with PC2 protein. pcsk2-scg5-1 1 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 2A Phosphorylated 7B2 fails to interact with pro-PC2.