IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. J. Biol. Chem. (0021-9258) 2006 imex curation Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu Accepted 2006-AUG-25 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. J. Biol. Chem. (0021-9258) 2006 imex curation Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. [32P]phosphopeptide fractions shown by the arrows in Figure 2 A are then analyzed by MALDI-TOF. scalderw@bidmc.harvard.edu Accepted 2006-AUG-25 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. J. Biol. Chem. (0021-9258) 2006 imex curation Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu Accepted 2006-AUG-25 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. J. Biol. Chem. (0021-9258) 2006 imex curation Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. Whole cell extracts were applied to a Superdex 200 HR 10/30 column. scalderw@bidmc.harvard.edu Accepted 2006-AUG-25 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding. J. Biol. Chem. (0021-9258) 2006 imex curation Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang X., Khaleque MA., Zhao MJ., Zhong R., Gaestel M., Calderwood SK. BioCreative - Critical Assessment of Information Extraction systems in Biology HSE sequence was not in the backreference given for the HSE. scalderw@bidmc.harvard.edu Accepted 2006-AUG-25 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation hsf1_human Heat shock factor protein 1 Heat shock transcription factor 1 HSF1 HSTF1 protein protein human Homo sapiens Human MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS DIP protein Q00613 original sequence version: 97 DIP protein Q00613 original sequence version: 157 DIP protein Q00613 original sequence version: 161 DIP protein Q00613-1 original sequence version: 161 735074507C954365 mapk2_human MAP kinase-activated protein kinase 2 MAPKAPK2 protein protein human Homo sapiens Human MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH E4EFFF11CCF288DC hsf1-mk2 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined thr334 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C Decrease in Phosphothreonine resulted in decrease in interaction. hsf1-mk2-1 5 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation 2A, 2B Increase in labelled 32P was observed upto about 4 hrs. NaSal inhibited 32P incorporation GST-HSF1 was phosphorylated by MK2 HSF1 is a direct substrate for phosphorylation by MK2 and that this phosphorylation may mediate the inhibitory effects of MK2 hsf1-mk2-2 2 7 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation 2D, 2E MK2 Directly Phosphorylates HSF1 HSF1 was phosphorylated. Sites phosphorylated 118-127 KVTSVSTLKS and 523-529 KAKDPTVS hsf1-mk2-3 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association HSP90 was also copurfied however whether the isoform A or B was purified could not be ascertained. 4A Role of serine 121 in HSF1-HSP90 binding. mk2-hsf1 3 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q00613:p.Ser121Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:29:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser121ala' Tue Jun 30 16:37:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser121Ala' Q00613:p.Ser121Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:36:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser121asp' Tue Jun 30 18:36:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser121Asp' physical association physical association Enodgenous HSP90 was immunoprecipitated in wild type cells. NaSal decreased this interaction. Heatshock results in disruption of the interaction and the lack of HSP90 interaction. 4B, 4C, 4D, 4E, 4F, 5 S121 was phosphorylated in HSF1. It is known that only a small fraction of transfected HSF1 is able to bind HSE and activate hsp transcription and this fraction appears to be the fraction that is not phosphorylated at serine 121 or bound to HSP90