IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. J. Biol. Chem. (0021-9258) 2006 imex curation Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca Accepted 2006-JUL-20 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. J. Biol. Chem. (0021-9258) 2006 imex curation Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca Accepted 2006-JUL-20 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation flii_helpy Flagellum-specific ATP synthase fliI HP_1420 protein protein helpy Helicobacter pylori Campylobacter pylori MPLKSLKNRLNQHFDLSPRYGSVKKIMPNIVYADGFNPSVGDVVKIEKSDGSECVGMVVVAEKEQFGFTPFNFIEGARAGDKVLFLKEGLNFPVGRNLLGRVLNPLGQVIDNKGALDYERLAPVITTPIAPLKRGLIDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMITRGCLAPIKVIALIGERGREIPEFIEKNLKGDLSSCVLVVATSDDSPLMRKYGAFCAMSVAEYFKNQGLDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSALSLLPQLMERAGKEENKGSITAFFSVLVEGDDLSDPIADQTRSILDGHIVLSRELTDYGIYPPINILNSASRVAKDIISESQNLCARKFRRLYALLKENEMLIRIGSYQMGNDKELDEAIKKKALMEQFLAQDENALQPFETSFQQLEEILR 6F04D67C988B4E22 o25120_helpy HP_0353 protein protein helpy Helicobacter pylori Campylobacter pylori MSLNSRKNLIQKDHLNKHDIQKYEFKNMANLPPKTNPNSASLETPNLEEPLEKKAIENDLIDCLLKKTDELSSHLVKLQMQFEKAQEESKVLIENAKNDGYKIGFKEGEEKMRNELTHSVNEEKNQLLHAITTLDEKMKKSEDHLMALEKELSAIAIDIAKEVILKEVEDNSQKVALALAEELLKNVLDATDIHLKVNPLDYPYLNERLQNASKIKLESNEAISKGGVMITSSNGSLDGNLMERFKTLKESVLENFKV 1EB2F2794CB4A969 flii-flii-1 2 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction The calculated molecular mass of FliI-(19�91) is 8.3 kDa, and hence we concluded that FliI-(19�91) is also most likely a trimer in solution. 2, 6B flih-flih-2 2 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction each of the truncated FliH molecules could exist either as trimers (56.7 and 48.6 kDa, respectively) or dimers (37.8 and 32.4 kDa, respectively). 2, 6B FliH can exist as trimers, or more commonly as dimers, under these experimental conditions. flii-flih-1 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 15 13 direct interaction direct interaction When tested for interactions with the four truncated FliH proteins (full-length FliH and FliH fragments 55�258, 94�258, and 117�258), FliI-(2�91) interacted with all of them by GST pulldown assay, and FliI-(19�91) interacted with none of them (Fig. 4, 4 flii-flih-2 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O07025:p.Leu3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:34:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu3ala' Tue Jun 30 19:32:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu3Ala' O07025:p.Leu6Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:53:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu6ala' Tue Jun 30 17:39:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu6Ala' O07025:p.Leu10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:18:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu10ala' Wed May 02 18:28:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu10ala' Tue Jun 30 16:08:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu10Ala' O07025:p.Leu6Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 20:16:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu6glu' Tue Jun 30 18:23:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu6Glu' O07025:p.Arg9Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg9glu' Wed May 02 17:41:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg9glu' Tue Jun 30 17:59:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg9Glu' ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction GST-pulldowns were conducted by using equimolar ratios of GST-FliH and each of the the respective purified FliI(2-91) mutant proteins. 5 flii-flih-3 2 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O07025:p.Leu3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:06:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu3ala' Tue Jun 30 17:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu3Ala' region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 30 34 direct interaction direct interaction We then demonstrated that the FliI -(2-91)-FliH-(117-258) complex is very stable in solution and can be isolated and purified by gel filtration chromatography (Fig. 6). 6, 7 The molecular weight of the complex is estimated at 1.3 x 10EXP6 D.