IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Shigella Spa33 is an essential C-ring component of type III secretion machinery. Shigella Spa33 is an essential C-ring component of type III secretion machinery. J. Biol. Chem. (0021-9258) 2006 imex curation Morita-Ishihara T., Ogawa M., Sagara H., Yoshida M., Katayama E., Sasakawa C. BioCreative - Critical Assessment of Information Extraction systems in Biology sasakawa@ims.u-tokyo.ac.jp 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Morita-Ishihara T., Ogawa M., Sagara H., Yoshida M., Katayama E., Sasakawa C. BioCreative - Critical Assessment of Information Extraction systems in Biology sasakawa@ims.u-tokyo.ac.jp Accepted 2006-JUL-24 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation q6xvz0_shifl ipaC protein protein shifl Shigella flexneri MEIQNTKSAPILYTDISTKQTQSSSETQKSQNYQQLAAHIPLNVGKNPVLTTTLNDDQLLKLSEQVQHDSEIIARLTDKKMKDLSEMSHTITPENTLDISSLSSNAVSLIISVAVLLSALRTAETRLGSQLSLIAFDATKSAAENIVRQGLAALSSSITGAVTQVGITGIGAKKTHSGISEQKGALRKNLATAQSLEKELAGSKLGLNKQIDTNITSPQTNSSTKILGKNKLAPDNISLSTEHKTSLSSPDISLQDKIDTQRRAYELNTLSAQQKQNIGRATMETSAVAGNISTSGGRYTSALEEEEQLISQASSKQAEEASQVSKEASQATNQLIQKLLNIIDNINQSRNSTASQIAGNIRA 61C5F521A2A46688 span_shifl Surface presentation of antigens protein SpaN spaN spa32 CP0151 Spa32 protein protein protein shifl Shigella flexneri MALDNINLNFSSDKQIEKCEKLSSIDNIDSLVLKKKRKVEIPEYSLIASNYFTIDKHFEHKHDKGEIYSGIKNAFELRNERATYSDIPESMAIKENILIPDQDIKAREKINIGDMRGIFSYNKSGNADKNFERSHTSSVNPDNLLESDNRNGQIGLKNHSLSIDKNIADIISLLNGSVAKSFELPVMNKNTADITPSMSLQEKSIVENDKNVFQKNSEMTYHFKQWGAGHSVSISVESGSFVLKPSDQFVGNKLDLILKQDAEGNYRFDSSQHNKGNKNNSTGYNEQSEEEC 78A112B3D24AB63C q3ytn9_shiss mxiN SSON_P103 protein protein shiss Shigella sonnei (strain Ss046) MKVCNMQKGTLPVSRHHAYDGVVIKRIEKELCKTIKDRDTESKKKAICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIIDYICEWKLKQNENRRNIEDYITSLLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNLALRKKLELDLHKYRSDVKIILKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFKELAHKKLRQIAEDLLKENPVND A9E90F9512705729 q6xvw8_shifl Protein-secreting ATPase spa47 protein protein shifl Shigella flexneri MSYIKLLTQLSFPNRISGPILETSLSDVSIGEICNIQAGIESNEIIARAQVVGFHDEKTILSLIGNSRGLSRQTLIKPTAQFLHTQVGRGLLGAVVNPLGEVTDKFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGVKVIDSLLTCGEGQRMGIFASAGCGKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDYSSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPVSVFDSLPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLAQKGQFPAIDSLKSISRVFTQVVDEKHRIMATAFRELLSEIEELRTIIDFGEYKPGENASQDKIYNKISVVESFLKQDYRLGFTYEQTMELLGETIR 5C66AAFD354B6668 vira_shifl Cysteine protease-like VirA virA Effector protein VirA pWR501_0191 CP0181 protein protein shifl Shigella flexneri MQTSNITNHERNDSSWMSTVKSTTEVSWNKLSFCDILLKIITFGIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV DDA0422BF215688F icsb_shifl Virulence protein IcsB icsB CP0132 protein protein shifl Shigella flexneri MSLKISNFIDASNTKGPIRVEDTEHGPILIAQKFNLKDLFFRTLSTINAKINSQILNEQLKNYRLENQKSLLLFLNTLASEKSAESAFAAYEAAKNSIQHSFTGRDIKLMLNTAERFHGIGTAKNLERHLVFRCWGNRGITHLGHTSISIKNNLLQEPTHTYLSWYPGGNVTKDTEINYLFEKRSGYSVDTYKQDKLNMISEQTAERLDAGQEVRNLLNSKQDQNNNKKIFFPRANQKKDPYGYWGVSADKVYIPLSGDNKTKDGKISHNLFGLDETNMSKFICKKKADAFRQLANYKLISKSENCAGMALNVLKAGNSEIYFPLPDVKLVATPNDVYAYANKVRQRIESLNQSYNEIMKYIESDFDLSRLTQLRRSYLKSFNKINLIHTPKTFKPLSISLYKHPTENVSSEDFDAVINACHSYLVKSAPSNMTRVLNELKTEATDKKEEIIEKSIKIIDYYNSLKSPDLGTKLYIHDLLQINKLLLNNSHSNI D4D2CC5EEC2B5324 q6xvw5_shifl Surface presentation of antigens protein SpaO spa33 protein protein shifl Shigella flexneri MLRIKHFDANEKLQILYAKQLCERFSIQTFKNKFTGSESLVTLTSVCGDWVIRIDTLSFLKKKYEVFSGFSTQESLLHLSKCVFIESSSVFSIPELSDKITFRITNEIQYATTGSHLCCFSSSLGIIYFDKMPVLRNQVSLDLLHHLLEFCLGSSNVRLATLKRIRTGDIIIVQKLYNLLLCNQVIIGDYIVNDNNEAKINLSESNGESDHTEVSLALFNYDDINVKVDFILLEKKMTINELKMYVENELFKFPDDIVKHVNIKVNGSLVGHGELVSIEDGYGIEISSWMVKE BBD4B9DC498C4FAD mxig_shifl Protein MxiG mxiG CP0136 protein protein shifl Shigella flexneri MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNGMYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSKERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLNDKHWFFLDKNK 9B137FE9A955C3E6 q6xvy7_shifl ipgB1 protein protein shifl Shigella flexneri MQILNKILPQVEFAIPRPSFDSLSHNKLVKKILSVFNLKQRFPQKNFGCPVNINKIRDSVIDKIKDSNSGNQLFCWMSQERTSYVSSMINRSIDEMAIHNGVVLTSDNKKNIFAAIEKKFPDIKLDEKSAQTSISHTALNEIASSGLRAKILKRYSSDMDLFNTQMKDLTNLVSSSVYDKIFNESTKVLQIEISAEVLKAVYRQSNTN DIP protein Q6XVY7 original sequence version: 14 9D04EB617E7A8A5A q6xvx7_shifl mxiK protein protein shifl Shigella flexneri MIRMDGIYKKYLSIIFDPAFYINRNRLNLPSELLENGVIRSEINNLIINKYDLNCDIEPLSGVTAMFVANWNLLPAVAYFIGSQESRLINHSEMVISYYGGKISKQGEAAIRSGFWHLIEWKENISVGIYERINLLFNPIALEGNYTPVERNLSRLNEGMQYAKRHFTGIQTSCL 2345D6E851BC75F0 q6xvx6_shifl mxiN protein protein shifl Shigella flexneri MKVCNMQKGTLPVSRHHAYDGVVIKRIEKELCKTIKDRDTESKKKAICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIIDYICEWKLKQNENRRNIEDYITSLLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNLALRKKLELDLHKYRSDVKIILKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFKELAHKKLRQIAEDLLKENPVND A9E90F9512705729 q56021_saltp Surface presentation of antigens protein SpaO spaO protein protein saltp Salmonella typhisuis MSLRVRQIDRREWLLAQTATECQRHGQEATLEYPTRQGMWVRLSDAEKRWSAWIQPGDWLEHVSPALAGAAVSAGAEHLVVPWLAATERPFELPVPHLSCRRLCVENPVPGSALPEGKLLHIMSDRGGLWFEHLPELPAVGGGRPKMLRWPLRFVIGSSDTQCSLLGRIGIGDVLLIRTSRAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEEENNTTETAETLPGLNQLPVKLEFVLYRKNVTLAELEVMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLSESGNGE D0A554886B675693 q6xvx8_shifl Lipoprotein mxiJ protein protein shifl Shigella flexneri MIRYKCFILFLLLMLIGCEQREELISNLSQRQANEIISVLERHNITARKVDGGKQGISVQVEKGTFASAVDLMRMYDLPNPERVDISQMFPTDSLVSSPRAEKARLYSAIEQRLEQSLVSIGGVISAKIHVSYDLEEKNISSKPMHISVIAIYDSPKESELLVSNIKRFLKNTFSDVKYENISVILTPKEEYVYTNVQPVKEIKSEFLTNEVIYVFLGMAVLVVILLVWAFKTGWFKRNKI B20516ED7F2C73D4 spa33-mxin 1 8 unspecified role unspecified role prey prey shifl Shigella flexneri 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3A spa33-mxik 1 8 unspecified role unspecified role prey prey shifl Shigella flexneri 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3A spa33-spa32 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3A spa33-spa47 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3A spa33-mxig 1 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain shifl Shigella flexneri physical association physical association Figure 2D spa33-mxij 1 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain shifl Shigella flexneri physical association physical association Figure 2D mxin-spa33 1 4 unspecified role unspecified role prey prey shifl Shigella flexneri 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3B spa32-spa33-1 1 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3B spa47-spa33 1 5 unspecified role unspecified role prey prey shifl Shigella flexneri 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3B spa33-spa47-1 1 5 unspecified role unspecified role prey prey shifl Shigella flexneri 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 3C spa33-spa32-1 1 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3C domain analysis of Spa33 involved in binding to MxiN, Spa32, or Spa47 by pull-down assay spa33-mxin-1 1 12 unspecified role unspecified role prey prey shifl Shigella flexneri 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6XVW5:p.Gly273Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G S Wed May 02 20:22:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly273ser' Tue Jun 30 16:47:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly273Ser' Q6XVW5:p.Ile286Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I Q Wed May 02 14:41:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile286gln' Tue Jun 30 16:03:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile286Gln' Q6XVW5:p.Leu242Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L Q Wed May 02 20:12:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu242gln' Tue Jun 30 17:36:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu242Gln' ecoli Escherichia coli (strain K12) physical association physical association Figure 3C and Figure 4D domain analysis of Spa33 involved in binding to MxiN, Spa32, or Spa47 by pull-down assay vira-spa33 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3D To test the possibility that Spa33 interacts with other translocating effectors, we used GST pull-down assays to investigate the capacity of Spa33 to interact with effectors, such as VirA, IcsB, IpaC, and IpgB1. icsb-spa33 1 8 unspecified role unspecified role prey prey shifl Shigella flexneri 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3D To test the possibility that Spa33 interacts with other translocating effectors, we used GST pull-down assays to investigate the capacity of Spa33 to interact with effectors, such as VirA, IcsB, IpaC, and IpgB1. ipac-spa33 1 8 unspecified role unspecified role prey prey shifl Shigella flexneri 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 3D To test the possibility that Spa33 interacts with other translocating effectors, we used GST pull-down assays to investigate the capacity of Spa33 to interact with effectors, such as VirA, IcsB, IpaC, and IpgB1. ipgb1-spa33 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association Figure 3D To test the possibility that Spa33 interacts with other translocating effectors, we used GST pull-down assays to investigate the capacity of Spa33 to interact with effectors, such as VirA, IcsB, IpaC, and IpgB1. mxik-spao 1 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay. mxin-spao 1 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay. spa32-spao 1 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay. spa47-spao 1 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay. mxig-spao 1 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay. mxij-spao 1 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Figure 5A We investigated the capacities of the Spa33 homologues SpaO, YscQ, and HrcQB to interact with MxiN and other Shigella-TTSM-associated proteins, i.e. MxiK, Spa32, Spa47, MxiG, and MxiJ, by GST-pull down assay.