IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. Eur. J. Immunol. (0014-2980) 1998 Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Eur. J. Immunol. (0014-2980) 1998 The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. Eur. J. Immunol. (0014-2980) 1998 Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Eur. J. Immunol. (0014-2980) 1998 The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2. Eur. J. Immunol. (0014-2980) 1998 Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gravestein LA., Amsen D., Boes M., Calvo CR., Kruisbeek AM., Borst J. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Eur. J. Immunol. (0014-2980) 1998 cd27_human CD27 antigen CD27L receptor T-cell activation antigen CD27 T14 Tumor necrosis factor receptor superfamily member 7 CD27 TNFRSF7 protein protein human Homo sapiens Human MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP 43C38B895B2AD4E2 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 cd27_mouse CD27 antigen CD27L receptor T-cell activation antigen CD27 Tumor necrosis factor receptor superfamily member 7 Cd27 Tnfrsf7 protein protein mouse Mus musculus Mouse MAWPPPYWLCMLGTLVGLSATLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP 48477C2E0C244697 traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 cd27-traf2 2 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association cd27-traf2-1 1 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association cd27-traf2-2 3 6 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-528957]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 251-251, sequence length 250 [EBI-528957]206-251 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association