IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. Cell (0092-8674) 1998 Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1998 The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. The C. elegans protein EGL-1 is required for programmed cell death and interacts with the Bcl-2-like protein CED-9. Cell (0092-8674) 1998 Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down predetermined predetermined participant predetermined Conradt B., Horvitz HR. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1998 egl1_caeel Programmed cell death activator egl-1 Egg-laying defective protein 1 egl-1 F23B12.9 protein protein caeel Caenorhabditis elegans MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYSSSQDFSSCEDSSQFADDSGFFDDSEISSIGYEIGSKLAAMCDDFDAQMMSYSAHASDRSLFHRLLDFFAF 2329D2DB0F019636 ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK DIP protein P41958 original sequence version: 125 DIP protein P41958 original sequence version: 83 7603675E490DD3EB ced-9-egl-1-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ced_9-egl_1-2 2 3 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association ced-9-egl-1-3 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bh3 -like domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association