IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 Prasad KV., Ao Z., Yoon Y., Wu MX., Rizk M., Jacquot S., Schlossman SF. Apoptosis - Interactions involving proteins with a function related to apoptosis human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Prasad KV., Ao Z., Yoon Y., Wu MX., Rizk M., Jacquot S., Schlossman SF. Apoptosis - Interactions involving proteins with a function related to apoptosis Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 Prasad KV., Ao Z., Yoon Y., Wu MX., Rizk M., Jacquot S., Schlossman SF. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Prasad KV., Ao Z., Yoon Y., Wu MX., Rizk M., Jacquot S., Schlossman SF. Apoptosis - Interactions involving proteins with a function related to apoptosis Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 siva_human Apoptosis regulatory protein Siva CD27-binding protein SIVA1 SIVA protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET DB62B7DF4E6B39B3 cd27_human CD27 antigen CD27L receptor T-cell activation antigen CD27 T14 Tumor necrosis factor receptor superfamily member 7 CD27 TNFRSF7 protein protein human Homo sapiens Human MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP 43C38B895B2AD4E2 cd27-siva 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association cd27-siva-1 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey gfp n terminal GFP tagged protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association