IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. Cell (0092-8674) 1996 Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time human-293t in Cabri are transformed with SV40 I guess the cell line authours refer to are tranfromed by EBV but there is no refence paper or cabri specific entry to create a new biosource. The cell line used in the experiment is transformed human 293-EBNA (Epstein-Barr virus nuclear antigen) from Invitrogen. Cell (0092-8674) 1996 Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death. Cell (0092-8674) 1996 Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boldin MP., Goncharov TM., Goltsev YV., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Time required for the double hybrid growth is reported for each interaction: A: growth within 30 minutes B: growth in 30 minutes - 2 hours time C: growth in 2 - 6 hours time Cell (0092-8674) 1996 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 q14790-5 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Beta-1 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNDFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH 7C9013CEA85A77DE q14790-1 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Alpha-1 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD 7A5FEAA6B39B582F fadd-fadd-2 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score A Fadd 1-79 fragments homodimerise with full lenght proteins but not with identical fragments. fadd-fadd-3 2 3 unspecified role unspecified role bait bait region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score A Fadd 1-79 fragments homodimerise with full lenght proteins but not with identical fragments. casp8b1-fadd-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score A casp8b1-casp8b1-1 2 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score A fadd-casp8b1-1 2 3 unspecified role unspecified role bait bait region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score A casp8a1-casp8b1-1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score B fadd-casp8b1-2 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association casp8a1-fadd-1 2 5 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:07:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 16:18:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score The point mutation on casp8 alfa-1 upgrade the interaction from C to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. casp8a1-fadd-2 2 5 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:05:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 20:15:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' 3 unspecified role unspecified role prey prey region possible binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score B The interaction is detected only with the Casp8 alfa-1 point mutant construct. casp8b1-casp8a1-1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:35:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 18:00:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' physical association physical association author score author-based confidence author score The point mutation on casp8 alfa-1 upgrade de interaction from B to A Wild type casp8 alfa-1 is cytotoxic while the non catalytic mutant is not fadd-casp8a1-1 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:52:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 19:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' physical association physical association author score author-based confidence author score The point mutation on casp8 alfa-1 upgrade the interaction from B to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. fadd-casp8a1-2 2 5 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:58:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 16:48:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score The point mutation on casp8 alfa-1 upgrade the interaction from C to A Wild type Casp8 alfa 1 is cytotoxic while the non catalytic point mutant is not. casp8a1-casp8a1-1 2 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:31:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 16:04:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' physical association physical association author score author-based confidence author score C The interaction is not detected when bait and prey are the cytotoxic wild type Casp8 alfa1 casp8a1-casp8a1-2 2 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait Q14790-1:p.Cys360Ser required mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:08:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 17:33:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' physical association physical association author score author-based confidence author score B The interaction is not detected when bait and prey are the cytotoxic wild type Casp8 alfa-1 fadd-casp8-1 1 5 unspecified role unspecified role prey prey Q14790-1:p.Cys360Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:06:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys360ser' Tue Jun 30 17:48:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys360Ser' 3 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey association association