IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. Cell (0092-8674) 1995 Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1995 FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. Cell (0092-8674) 1995 Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1995 FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. FADD, a novel death domain-containing protein, interacts with the death domain of Fas and initiates apoptosis. Cell (0092-8674) 1995 Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Tewari M., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 1995 tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 tnfrsf6-fadd-10 1 5 unspecified role unspecified role prey prey death domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain deletion necessary but not sufficient binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-518506]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 336-336, sequence length 335 [EBI-518506]313-336 physical association physical association tnfrsf6-fadd-12 3 4 unspecified role unspecified role bait bait deletion necessary but not sufficient binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25445:p.Val254Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V N Wed May 02 16:03:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val254asn' Tue Jun 30 17:04:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val254Asn' cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association val254asn is a point mutation in FAS death domain known as lpr (lupus-like lymoproliferative autoimmune disorder in mice) tnfrsf6-fadd-13 3 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25445:p.Val254Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V N Wed May 02 16:15:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val254asn' Tue Jun 30 19:48:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val254Asn' cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain deletion binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13158:p.Val121Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V N Wed May 02 15:37:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val121asn' Tue Jun 30 17:51:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val121Asn' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association val254asn is a point mutation in FAS death domain known as lpr (lupus-like lymoproliferative autoimmune disorder in mice) val121asn is the corresponding lpr mutation of the FADD death domain tnfrsf6-fadd-14 2 5 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined deletion necessary but not sufficient binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P25445:p.Val254Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V N Wed May 02 20:32:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val254asn' Tue Jun 30 18:46:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val254Asn' 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association val254asn is a point mutation in death domain known as lpr (lupus-like lymoproliferative autoimmune disorder in mice)