IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. J. Biol. Chem. (0021-9258) 1995 Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA J. Biol. Chem. (0021-9258) 1995 A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. J. Biol. Chem. (0021-9258) 1995 Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA J. Biol. Chem. (0021-9258) 1995 A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. J. Biol. Chem. (0021-9258) 1995 Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA J. Biol. Chem. (0021-9258) 1995 A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain. J. Biol. Chem. (0021-9258) 1995 Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA in vitro In vitro pull down pull down predetermined predetermined participant predetermined Boldin MP., Varfolomeev EE., Pancer Z., Mett IL., Camonis JH., Wallach D. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - Human HeLa cell cDNA J. Biol. Chem. (0021-9258) 1995 tnr6_mouse Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen protein protein mouse Mus musculus Mouse MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE DIP protein P25446 original sequence version: 112 D8DA95CA525CED56 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 tnfrsf6-fadd-1 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association tnfrsf6-fadd-2 1 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-494871]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 246-246, sequence length 208 [EBI-494871]131-246 16 14 physical association physical association tnfrsf6-fadd-3 1 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-494883]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 246-246, sequence length 208 [EBI-494883]131-246 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P25446:p.Ile225Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 17:30:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile225asp' Tue Jun 30 16:36:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile225Asp' 19 21 physical association physical association fadd-fadd-1 1 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 27 25 physical association physical association tnfrsf6-tnfrsf6-1 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 32 30 physical association physical association tnfrsf6-fadd-4 1 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P25446:p.Ile225Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 18:04:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile225asp' Tue Jun 30 19:41:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile225Asp' 37 35 physical association physical association tnfrsf6-fadd-5 1 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-494986]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 246-246, sequence length 208 [EBI-494986]131-246 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 43 41 physical association physical association tnfrsf6-fadd-6 4 6 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association tnfrsf6-fadd-7 4 5 unspecified role unspecified role bait bait P25446:p.Ile225Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D Wed May 02 20:17:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile225asp' Tue Jun 30 16:03:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile225Asp' region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 6 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association tnfrsf6-fadd-8 2 6 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association tnfrsf6-fadd-9 2 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 6 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association