IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology chip-chip chromatin immunoprecipitation array chip-chip tag fluorescence tag visualisation by fluorescence tag fluorescence O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis It has been assumed that SW480 cells were used in Fig S4G, but this has not been confirmed. UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. Multiple intestinal neoplasia (Min) mice infected with the the human commensal organism "enterotoxigenic Bacteroides fragilis" - (ETBF), which induces inflammation and tumorigenesis primarily in the distal colon- an in-vivo model of colitis. Min mice are heterozygous for loss of Adenomatous polyposis coli (Apc). No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Flag-DNMT1 (Human) has been entered, but this has not been confirmed by the authors. UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. distal colon epithelial cells from Min mice, sham and ETBF treated. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. Cancer Cell (1535-6108) 2011 imex curation O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis UniProt states for Human EED: Note: Additional isoforms may be produced by alternative initiation, both from non-canonical start codons upstream of the initiator methionine displayed and from other canonical start codons downstream of that displayed. This paper refers to an EED- Isoform 2 - but references I trace this isoform back to refer to a much longer mol (~500/535 aas) than any currently in UniProt (or NCBI). EED-2 is meant to be aas 35-535 of this long form. In UniProt the longest form was version 47 and before - having only 517 aa. NCBI no more help. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation fbn1_mouse_gene FBN1_MOUSE_GENE gene gene mouse Mus musculus Mouse myl6_human_gene MYL6_HUMAN_GENE gene gene human Homo sapiens Human h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 epmip_human_gene EPM2AIP1_HUMAN_GENE gene gene human Homo sapiens Human myl6b_human_gene MYL6B_HUMAN_GENE gene gene human Homo sapiens Human rl10a_human_gene RPL10A Human gene gene gene human Homo sapiens Human rl13_human_gene RPL Human gene gene gene human Homo sapiens Human sox17_mouse_gene SOX17_MOUSE_GENE gene gene mouse Mus musculus Mouse sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F gata4_human_gene GATA4_HUMAN_GENE gene gene human Homo sapiens Human timp3_human_gene TIMP3_HUMAN_GENE gene gene human Homo sapiens Human sfrp2_human_gene SFRP2_HUMAN_GENE gene gene human Homo sapiens Human epdr1_human_gene EPDR1_HUMAN_GENE gene gene human Homo sapiens Human sfrp5_mouse_gene SFRP5_MOUSE_GENE gene gene mouse Mus musculus Mouse suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B xct_human_gene XCT_HUMAN_GENE/SLC7A11 gene gene human Homo sapiens Human ptn_human_gene PTN_HUMAN_GENE gene gene human Homo sapiens Human eed_mouse Polycomb protein EED Eed protein protein mouse Mus musculus Mouse MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein Q921E6 original sequence version: 48 DIP protein Q921E6 original sequence version: 73 DIP protein Q921E6 original sequence version: 98 D2E0A5BA27C0499A dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE DIP protein Q9UBC3 original sequence version: 148 DIP protein Q9UBC3 original sequence version: 83 F20A67CF78951532 gata5_human_gene GATA5_HUMAN_GENE gene gene human Homo sapiens Human dnmt1_mouse DNA (cytosine-5)-methyltransferase 1 Dnmt1 Dnmt Met1 Uim MCMT DNA methyltransferase MmuI protein protein mouse Mus musculus Mouse MPARTAPARVPALASPAGSLPDHVRRRLKDLERDGLTEKECVREKLNLLHEFLQTEIKSQLCDLETKLHKEELSEEGYLAKVKSLLNKDLSLENGTHTLTQKANGCPANGSRPTWRAEMADSNRSPRSRPKPRGPRRSKSDSDTLSVETSPSSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKRRVVDTESGAAAAVEKLEEVTAGTQLGPEEPCEQEDDNRSLRRHTRELSLRRKSKEDPDREARPETHLDEDEDGKKDKRSSRPRSQPRDPAAKRRPKEAEPEQVAPETPEDRDEDEREEKRRKTTRKKLESHTVPVQSRSERKAAQSKSVIPKINSPKCPECGQHLDDPNLKYQQHPEDAVDEPQMLTSEKLSIYDSTSTWFDTYEDSPMHRFTSFSVYCSRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNLGPINQWWLSGFDGGEKVLIGFSTAFAEYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQNNPDAVYEDLINKIETTVPPSTINVNRFTEDSLLRHAQFVVSQVESYDEAKDDDETPIFLSPCMRALIHLAGVSLGQRRATRRVMGATKEKDKAPTKATTTKLVYQIFDTFFSEQIEKYDKEDKENAMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKKLHQGKKKKQNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVLGATSDPLELFLVGECENMQLSYIHSKVKVIYKAPSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQPTEDNKHKFCLSCIRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWSDEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVSEPKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVRLGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSARESASAAVKAKEEAATKD 4F9A98CEAF09F037 eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein O75530 original sequence version: 70 DIP protein O75530-1 original sequence version: 78 DIP protein O75530 original sequence version: 78 DIP protein O75530 original sequence version: 73 DIP protein O75530-1 original sequence version: 89 DIP protein O75530-1 original sequence version: 87 DIP protein O75530 original sequence version: 77 D2E0A5BA27C0499A myc_human_gene Human c-myc gene gene gene human Homo sapiens Human mlh1_human_gene MLH1_HUMAN_GENE gene gene human Homo sapiens Human dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD DIP protein P26358 original sequence version: 171 DIP protein P26358-1 original sequence version: 121 DIP protein P26358 original sequence version: 121 DIP protein P26358-1 original sequence version: 128 DIP protein P26358 original sequence version: 128 1E833192D22AFA5B sfrp5_human_gene SFRP5_HUMAN_GENE gene gene human Homo sapiens Human actb_human_gene ACTB_HUMAN_GENE/Actin B gene gene human Homo sapiens Human se6l1_mouse_gene SE6L1_MOUSE_GENE/SEZ6L gene gene mouse Mus musculus Mouse ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 sfrp4_human_gene SFRP4_HUMAN_GENE gene gene human Homo sapiens Human pkha6_human_gene PKHA6_HUMAN_GENE/PLEKHA6 gene gene human Homo sapiens Human dnmt1-sirt1-4 7 17 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association 2A An interaction was only observed only after 30 minutes hydrogen peroxide exposure, or longer. dnmt1-eed-4 4 31 unspecified role unspecified role prey prey 38 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey association association 2B hydrogen peroxide sirt1-dnmt1-4 7 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey 38 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey association association 2C hydrogen peroxide remove inappropriate EEd isoforms! dnmt3b-sirt1 7 28 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey 38 unspecified role unspecified role prey prey association association 2D, 3B. hydrogen peroxide After H2O2 treatment, it can be seen the proteins are present in a much larger complex(es), and that after H2O2 treatment, SIRT1 interacts with DNMT3B. dnmt1-ezh2-3 5 11 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 38 unspecified role unspecified role neutral component neutral component association association 4 After H2O2 treatment, DNMT1, SIRT1, and DNMT3B, and to a lesser extent SUZ12, EZH2, and EED proteins all migrate in the gradient in regions of higher molecular mass (greater than 650 kDa) than in untreated cells. dnmt1-eed-5 4 38 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3C hydrogen peroxide As for DNMT3B, DNMT1 interacts with EZH2 and SIRT1 as part of a large multiprotein complex(es) after H2O2 treatment. ezh2-dnmt1-2 4 31 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey 34 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3D hydrogen peroxide In this Re-IP, an initial co-IP was carried out using FLAG-DNMT1 as bait, then a second IP was done using anti-EZH2 antibodies. dnmt3b-dnmt1-1 1 28 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 38 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component colocalization colocalization 3A After H2O2 treatment, DNMT1, SIRT1, and DNMT3B, and to a lesser extent SUZ12, EZH2, and EED proteins all migrate in the gradient in regions of higher molecular mass (greater than 650 kDa) than in untreated cells. myc-sirt1 2 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-h2afx 2 11 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-dnmt1 2 34 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-ezh2-4 2 38 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-dnmt3b 2 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-actb 2 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-actb-1 2 36 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-actb 2 36 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-actb-1 2 36 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-actb-1 2 11 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-rl13 2 15 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-rl13 2 28 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-rl13 2 34 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-rl13 2 11 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-actb-1 2 36 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-rl10a 2 14 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-rl10a 2 11 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-rl10a 2 14 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-rl10a 2 14 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-rl10a 2 14 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-sfrp4 2 17 unspecified role unspecified role bait bait 39 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1 2 11 unspecified role unspecified role bait bait 39 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-sfrp4 2 34 unspecified role unspecified role bait bait 39 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b 2 39 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-sfrp4 2 39 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-epdr1 2 38 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-2 2 28 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-epdr1 2 34 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-1 2 11 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-1 2 21 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-epdr1 2 17 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-2 2 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-2 2 34 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-2 2 12 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-3 2 38 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-epmip 2 33 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-4 2 28 unspecified role unspecified role bait bait 33 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-3 2 34 unspecified role unspecified role bait bait 33 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-3 2 11 unspecified role unspecified role bait bait 33 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-3 2 33 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-mlh1 2 35 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-4 2 11 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-4 2 35 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-4 2 28 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-5 2 35 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-sfrp5 2 38 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-6 2 28 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-5 2 34 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-5 2 11 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-5 2 19 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-gata4 2 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-6 2 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-6 2 18 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-6 2 28 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-7 2 38 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-gata4 2 29 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-8 2 28 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-7 2 29 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-7 2 11 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-7 2 17 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-gata5 2 17 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-8 2 11 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-8 2 20 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-8 2 28 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-9 2 20 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-dnmt1-3 3 24 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey association association The DNMT1 band is more prominent in the tissue from the distal colon of the ETBF mice. 7B, S6D. ezh2-fbn1 6 9 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-fbn1 6 9 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-fbn1-1 6 37 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-se6l1 6 37 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-se6l1-1 6 22 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-sfrp5 6 30 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-sfrp5-1 6 16 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role bait bait association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-sox17 6 24 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt3b-myc 8 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-myc 8 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 38 unspecified role unspecified role bait bait association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). h2afx-myc 8 11 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). sirt1-myc-1 8 17 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt1-myc 8 32 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 34 unspecified role unspecified role bait bait association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). h2afx-actb-2 8 11 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt1-actb-2 8 36 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-actb-2 8 38 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). sirt1-actb-2 8 17 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt3b-actb-1 8 36 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-myl6b-1 2 13 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-ptn-1 2 38 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-myl6-2 2 10 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-xct-1 2 38 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-pkha6-1 2 40 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-pkha6-1 2 28 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-myl6b-1 2 28 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-myl6-2 2 10 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-ptn-1 2 26 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-xct-1 2 25 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-pkha6-1 2 17 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-myl6b-1 2 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-myl6-2 2 17 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-ptn-1 2 17 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-xct-1 2 25 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-pkha6-1 2 34 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-myl6b-1 2 13 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-myl6-2 2 10 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-ptn-1 2 34 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-xct-1 2 25 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-pkha6-1 2 11 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-myl6b-1 2 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-myl6-2 2 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-ptn-1 2 11 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey association association S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-xct-1 2 11 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. S4G