IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-2ftgh Human 2fTGH cells 2ftgh 2fTGH parental cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Time after Sendai viral infection (hours). Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Time after Sendai viral infection (hours). Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Time after Sendai viral infection (hours). 2 6 12 Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Time after Sendai viral infection (hours). Cell (0092-8674) 2011 Only protein-protein interactions imex curation Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Activation of STAT6 by STING Is Critical for Antiviral Innate Immunity. Cell (0092-8674) 2011 imex curation Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn 14-Mar-2012: Contacted by JYOTI. Human leukocyte cDNA Only protein-protein interactions human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen H., Sun H., You F., Sun W., Zhou X., Chen L., Yang J., Wang Y., Tang H., Guan Y., Xia W., Gu J., Ishikawa H., Gutman D., Barber G., Qin Z., Jiang Z. Apoptosis - Interactions involving proteins with a function related to apoptosis jiangzf@pku.edu.cn Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. Time after Sendai viral infection (hours). Human leukocyte cDNA Cell (0092-8674) 2011 Only protein-protein interactions imex curation tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9WUN2 original sequence version: 53 DIP protein Q9WUN2 original sequence version: 101 DIP protein Q9WUN2 original sequence version: 100 DIP protein Q9WUN2 original sequence version: 93 978ADDE3061DACD1 stat6_mouse Signal transducer and transcription activator 6 Stat6 protein protein mouse Mus musculus Mouse MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSATVQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGPFHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLATMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQEIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQFLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQKIFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPEPQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNMSQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSEDMYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW DIP protein P52633 original sequence version: 122 DIP protein P52633 original sequence version: 93 082E0A15C7457307 stat6_human Signal transducer and activator of transcription 6 IL-4 Stat STAT6 protein protein human Homo sapiens Human MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW DIP protein P42226 original sequence version: 150 F35075F1C1F2A677 sting_mouse Stimulator of interferon genes protein Sting1 Endoplasmic reticulum interferon stimulator Eris Mediator of IRF3 activation Mita Mpys Tmem173 Transmembrane protein 173 protein protein mouse Mus musculus Mouse MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9UHD2 original sequence version: 116 DIP protein Q9UHD2 original sequence version: 120 DIP protein Q9UHD2 original sequence version: 79 DIP protein Q9UHD2 original sequence version: null B58E4FE1B502276D sting_human Stimulator of interferon genes protein STING1 ERIS Endoplasmic reticulum interferon stimulator MITA Mediator of IRF3 activation TMEM173 Transmembrane protein 173 protein protein human Homo sapiens Human MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS DIP protein Q86WV6 original sequence version: 83 DIP protein Q86WV6 original sequence version: 47 DIP protein Q86WV6 original sequence version: 50 DIP protein Q86WV6 original sequence version: 100 DIP protein Q86WV6 original sequence version: 68 CB54D6A4D4D8E7C0 irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH 0E23E3E115941EE8 tmem173-stat6 4 16 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association stat6-tmem173 3 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait dbd region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Figs. 2A, 2B tmem173-stat6-1 3 19 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey dbd region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2C stat6-tmem173-1 3 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association SUpp. Fig. 2D stat6-tmem173-2 9 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 10 Supp. Fig. 1E stat6-mavs-4 9 21 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey association association 11 Supp. Fig. 1E stat6-tmem173-3 2 16 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 1A stat6-mavs-1 9 21 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association 12 Supp. Fig. 1E tmem173-stat6-2 8 17 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig. 1B 2 tmem173-stat6-3 8 17 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig. 1B 6 stat6-mavs-2 7 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey association association Supp. Fig. 1E 6 stat6-tbk1 7 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 1E 2 stat6-tbk1-1 13 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Supp. Fig. 1E 2 stat6-mavs-3 13 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Supp. Fig. 1E 6 stat6-stat6 3 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2M Sendai virus infection stat6-4 5 16 unspecified role unspecified role neutral component neutral component physical association physical association Supp. Fig 2N Sendai virus infection Leu551Ala prevents viral-induced dimerization but has no effect on that induced by IL-4. irf3-1 5 20 unspecified role unspecified role neutral component neutral component physical association physical association Supp Fig. 2N mavs-stat6 1 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 4D TH173 is required for complex formation. stat6-tbk1-2 6 18 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P42226:p.Ser407Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:32:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser407ala' Tue Jun 30 18:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser407Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Phosphorylation of peptide STAT6 358–427 was greatly impaired in Ser407Ala was mutated. Phosphorylation of Ser-407 Fig. 6E