IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. Structure (0969-2126) 2011 imex curation Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis The cleavage reaction was performed, thrombin-digested and then the components were separated in a glycerol gradient to determine which of those were co-migrating (binding). cakey@bu.edu Accepted 2011-AUG-24 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Structure (0969-2126) 2011 Only protein-protein interactions imex curation The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. Structure (0969-2126) 2011 imex curation Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protease access protease accessibility laddering pal pal protease access weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Accepted 2011-AUG-24 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Structure (0969-2126) 2011 Only protein-protein interactions imex curation The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. Structure (0969-2126) 2011 imex curation Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation ms participant Identification by mass spectrometry ms participant Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Accepted 2011-AUG-24 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Structure (0969-2126) 2011 Only protein-protein interactions imex curation The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. Structure (0969-2126) 2011 imex curation Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu Accepted 2011-AUG-24 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Structure (0969-2126) 2011 Only protein-protein interactions imex curation The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3. Structure (0969-2126) 2011 imex curation Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis cakey@bu.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Yuan S., Yu X., Asara J.M., Heuser J.E., Ludtke S.J., Akey C.W. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of Caspase-3 taken from previous work of contidutor (PMID: 19788411) cakey@bu.edu Accepted 2011-AUG-24 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Structure (0969-2126) 2011 Only protein-protein interactions imex curation casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A cyc_bovin Cytochrome c CYCS CYC protein protein bovin Bos taurus (Bovine) Bovine MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE DIP protein P62894 original sequence version: 62 AF0CA628EDF40483 casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS DIP protein P55211 original sequence version: 174 DIP protein P55211 original sequence version: 167 DIP protein P55211 original sequence version: 124 DIP protein P55211 original sequence version: 125 DIP protein P55211 original sequence version: 123 DIP protein P55211 original sequence version: 153 78E0180DF2A3BDD2 apaf_human Apoptotic protease-activating factor 1 APAF1 KIAA0413 protein protein human Homo sapiens Human MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGSSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHHSTIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTSSDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLTEAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE DIP protein O14727 original sequence version: 177 DIP protein O14727 original sequence version: 127 0750D05817AC9B3B apaf1-casp9-22 3 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role neutral component neutral component purified purified P55211:p.[Glu306Ala;Asp315Ala;Asp330Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 11:08:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306ala,asp330ala,asp315ala' Wed May 02 14:43:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu306ala,asp315ala,asp330ala' Tue Jun 30 17:36:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu306Ala;Asp315Ala;Asp330Ala]' This mutation prevents self-cleavage of casp9. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] physical association physical association Stochiometry adapted from 1:0.8 values given in the paper in order to use integers. S2b and S2c apaf1-casp9-23 3 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role neutral component neutral component purified purified tev cleaving site uncategorized protein modification uncategorized protein modification certain certain sequence position certain range range P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:00:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 17:31:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents self-cleavage of casp9. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Stochiometry adapted from 1:0.8 values given in the paper in order to use integers. S2a and S2c apaf1-casp9-26 4 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range casp9 without card region experimental feature experimental feature range range certain certain sequence position certain This region was eliminated via thrombin cleavage. P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:57:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 16:12:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents self-cleavage of casp9. ecoli Escherichia coli (strain K12) physical association physical association 1a, 1b and 1c apaf1-casp3-7 5 7 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 8 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:53:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 16:42:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents casp9 self-cleavage. ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:16:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 17:13:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage 3d Procaspase-9 has a potential linker of approximately 69 residues between the CARD and p20 domain, reducing the size of this linker reduced the catalytic activity of Caspase-9. apaf1-casp9-24 4 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 8 unspecified role unspecified role neutral component neutral component purified purified casp9 without card region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain This region was eliminated via thrombin cleavage. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:27:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 19:31:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents self-cleavage of casp9. deletion 30l sufficient to bind sufficient binding region sufficient to bind n-term range n-terminal range n-term range certain certain sequence position certain certain certain sequence position certain c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. physical association physical association 3E apaf1-casp3-6 5 7 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:46:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 19:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation was intended to block casp9 self-cleavage, but it also decreased its casp3-cleaving activity. thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:43:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 18:21:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage 4a Caspase-9 asp315ala displays significantly reduced cleavage activity. apaf1-casp9-25 4 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 5a-e, S5b, S6a and S6b apaf1-casp9-27 4 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 8 unspecified role unspecified role neutral component neutral component purified purified P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:32:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 19:19:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents self-cleavage of casp9. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range casp9 without card region experimental feature experimental feature range range certain certain sequence position certain This region was eliminated via thrombin cleavage. ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. physical association physical association 6a-d apaf1-casp3-9 1 7 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 8 enzyme enzyme neutral component neutral component purified purified card region cleaved sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain range range This region was eliminated via thrombin cleavage. P55211:p.Asp315Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:08:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 20:00:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation was intended to block casp9 self-cleavage, but it also decreased its casp3-cleaving activity. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:32:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 16:07:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage 7a and 7b Unprocessed casp3 does not bind to the casp9-apaf1 complex. Thrombin cleavage of casp9-card region was performed before casp3 addition, showing that unprocessed casp3 does not bind to the apaf1 platform without processing. apaf1-casp3-8 5 8 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain P55211:p.Asp315Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 20:20:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 19:21:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation was intended to block casp9 self-cleavage, but it also decreased its casp3-cleaving activity. ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:49:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 16:07:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. cleavage cleavage reaction cleavage 4a The Caspase-9 asp315ala mutation in the p20-p10 linker has a significant effect on the final level of pc-9 activation apaf1-casp3-10 1 7 unspecified role unspecified role ancillary ancillary purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 8 enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range card region cleaved sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range This region was eliminated via thrombin cleavage. ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:51:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 16:56:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) cleavage cleavage reaction cleavage 7c In this variation of the experiment, casp3 was added before thrombin cleavage and removal of casp9-card region, showing that processed casp3 binds directly to the apaf1 platform. apaf1-casp3-12 2 7 unspecified role unspecified role neutral component neutral component purified purified bovin-heart Bos taurus heast heart Heart [Cardiac; Cardiac tissue] 9 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range thrombin site uncategorized protein modification uncategorized protein modification certain certain sequence position certain certain certain sequence position certain P55211:p.Asp315Ala mutation mutation certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:34:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp315ala' Tue Jun 30 17:35:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp315Ala' This mutation prevents casp9 self-cleavage. ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified P42574:p.Cys163Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Wed May 02 14:56:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ala' Tue Jun 30 20:22:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ala' This mutation prevented self-cleavage of casp3. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 7d Processed casp3 (active dimer) protects casp9 from thrombin cleavage.