InnateDB InnateDB The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. Nat. Immunol. (1529-2908) 2011 imex curation Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Fig 7A - these must be Mouse rather than Human cells as there is no mention of KO human cells in the paper. Fig 7b and Figure 1 have interactions that have not been annotated. Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. Nat. Immunol. (1529-2908) 2011 imex curation Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. The inducible kinase IKKi is required for IL-17-dependent signaling associated with neutrophilia and pulmonary inflammation. Nat. Immunol. (1529-2908) 2011 imex curation Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bulek K., Liu C., Swaidani S., Wang L., Page R.C., Gulen M.F., Herjan T., Abbadi A., Qian W., Sun D., Lauer M., Hascall V., Misra S., Chance M., Aronica M., Hamilton T., Li X. Apoptosis - Interactions involving proteins with a function related to apoptosis Post IP, beads were washed X4. Recombinant GST-Ikki was purchased from Active Motif, which only sell human Ikki (IKK-epislon). lix@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity ikke_human Inhibitor of nuclear factor kappa-B kinase subunit epsilon IKBKE IKKE IKKI KIAA0151 Inducible I kappa-B kinase protein protein human Homo sapiens Human MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLGAGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV DIP protein Q14164 original sequence version: 139 DIP protein Q14164 original sequence version: 148 DIP protein Q14164 original sequence version: 108 3E5FBE5840734D81 traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV DIP protein P70196 original sequence version: 139 DIP protein P70196 original sequence version: 128 DIP protein P70196 original sequence version: 144 DIP protein P70196 original sequence version: 83 DIP protein P70196 original sequence version: 98 DIP protein P70196 original sequence version: 104 DIP protein P70196 original sequence version: 112 DIP protein P70196 original sequence version: 163 F8389250425E4E2D traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL DIP protein P70191 original sequence version: 132 48F64FB83BD587E5 ikke_mouse Inhibitor of nuclear factor kappa-B kinase subunit epsilon Ikbke Ikke Ikki Inducible I kappa-B kinase protein protein mouse Mus musculus Mouse MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLRRLNHQNIVKLFAVEETGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAISGTQKQENGPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFAETSDILQRTVIHVFSLPQAVLHHVYIHAHNTIAIFLEAVYEQTNVTPKHQEYLFEGHPCVLEPSLSAQHIAHTAASSPLTLFSMSSDTPKGLAFRDPALDVPKFVPKVDLQADYSTAKGVLGAGYQALWLARVLLDGQALMLRGLHWVLEVLQDTCQQTLEVTRTALLYLSSSLGTERFSSGAGMPDVQERKEATELRTRLQTLSEILSKCSHNVTETQRSLSCLGEELLKNRDQIHEDNKSIQKIQCCLDKMHFIYKQFKKSRMRPGLSYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQTYQVSLVTHGKRMRQVQRAQNHLHLIGHSVATCNSEARGAQESLNKIFDQLLLDRASEQGAEVSPQPMAPHPGPDPKDLVFHMQELCNDMKLLAFDLQDNNRLIERLHRVPSAPDV 0863ECC180AE385A ciks_mouse E3 ubiquitin ligase TRAF3IP2 Traf3ip2 Adapter protein CIKS Connection to IKK and SAPK/JNK E3 ubiquitin-protein ligase CIKS Nuclear factor NF-kappa-B activator 1 TRAF3-interacting protein 2 protein protein mouse Mus musculus Mouse MNRSIPVEVDESEPFPSQLLKPIPEYSPEEELEPPAPNTRNMAPSSLSVLQCPPLKLANHQPVSQQVTCLRAKVLEEGEASFFRRHPELGKDISSCSSGASEPESELGALPPEHRFTLTEKRNRWLGSQLSAASPDTGHESDKSDPSLPNALADSFSGGQEMMPRPRPRPGPHRHRAAPDVPTIDTGYDSQPQDVLGIRQLERPLPLTSSCYLQDLPGPLRSRELPPQFELERYPMNAQLLPPHPSPQAPWNCQYYCPGGPYHHQVPHGHGYPPAAAYQQVLQPALPGQVLPGARARGPRPVQKVILNDSSPQDQEERPAQRDFSFPRLPRDQLYRPPSNGVEAPEESLDLPAELRPHGPQAPSLAAVPRPPSNPLARGTLRTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFISQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL 54B40C8D81C3D827 traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 ikbke-traf3ip2-1 3 8 enzyme target enzyme target substrate substrate neutral component neutral component 4 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig. 5C ikbke-1 3 4 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. phosphorylation phosphorylation reaction phosphorylation true Fig. 5D traf3ip2-ikbke 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 1A IL-17 ikbke-traf3ip2-2 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role bait bait physical association physical association Fig. 1C IL-17 traf3ip2-traf2 1 8 unspecified role unspecified role bait bait Q8N7N6:p.Ser311Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:56:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser311ala' Tue Jun 30 15:34:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser311Ala' 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 7B IL-17 ikbke-traf2-1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 7A IL-17 In Ikki null cells, Act1 can only CoIP TRAF6.