IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-lung Mus musculus lung anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-spleen Mus musculus spleen spleen spleen anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-apl-primary Human acute promyelocytic leukemia primary cells apl-primary Acute promyelocytic leukemia primary cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. Blood (0006-4971) 2011 imex curation Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Accepted 2012-MAR-16 by JYOTI 19-Jun-2012: Contacted by JYOTI. Blood (0006-4971) 2011 Only protein-protein interactions imex curation ch-11 antibody ch-11 hFAS-activating monoclonal antibody protein protein mouse Mus musculus Mouse affinomics Monoclonal antibody developed in mouse cells against human protein FAS (P25445). tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL DIP protein P48023 original sequence version: 165 DIP protein P48023-1 original sequence version: 126 DIP protein P48023-1 original sequence version: 130 DIP protein P48023 original sequence version: 152 A8A6EB358246E9BB cflar_human CASP8 and FADD-like apoptosis regulator Cellular FLICE-like inhibitory protein Caspase-eight-related protein Caspase-like apoptosis regulatory protein MACH-related inducer of toxicity Caspase homolog Inhibitor of FLICE FADD-like antiapoptotic molecule 1 Usurpin CFLAR CASH CLARP MRIT CASP8AP1 protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT 8C6D7E92AE1EB672 q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP 8C16B6E85CBDD214 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 pml_mouse Protein PML Pml protein protein mouse Mus musculus Mouse METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAEQAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCLEAPGLQCPICKAPGQADANGEALDNVFFESLQRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDSTRKSNIFCSNTNHRNPALTDIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVASPEAASNQPEAASTHPVTTSTPEDLEQPKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYREEASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLSSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA DIP protein Q60953 original sequence version: 147 DIP protein Q60953 original sequence version: 62 pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 tnr6_mouse Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen protein protein mouse Mus musculus Mouse MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE DIP protein P25446 original sequence version: 112 D8DA95CA525CED56 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 fas-pml 1 18 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association 1b fas-pml-1 3 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association 1b fas-pml-3 11 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b fas-pml-4 5 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b fas-pml-5 2 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b fas-pml-7 12 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b fas-pml-8 7 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b fas-pml-9 6 21 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 4b ch_11_antibody-fas 10 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 5a affinomics Induction of the expression of PML-RAR-alpha through ZnSO4 treatment decreases the interaction. faslg-fas 10 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 5b Induction of the expression of PML-RAR-alpha through ZnSO4 treatment decreases the interaction. faslg-fas-1 8 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 5c Knock-down of PML-RAR-alpha increases the interaction. fas-casp8-13 10 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association 6a pml-fas-1 4 20 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range b-box-containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey physical association physical association 7b left fas-pml-11 3 18 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey b-box-containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7b middle and right fas-pml_rar 8 18 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 1a, 1d pml_rar-fas 8 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1a fas-casp8-14 10 18 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey association association 6a Expression and co-inmunoprecipitation of PML-RARA dependent of ZnSO4 treatment. cflar-pml_rar 8 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 6b (left) fas-cflar 9 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association 6b (right) and 1c fas-pml_rar-1 4 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait plad containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dd containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 7d fas-cflar-1 7 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 7g Cells were treated with anti-fas antibody to induce apoptosis.