IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. The HCT116 cell line used in this experiment was p53 +/+. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. The HCT116 cell line used in this experiment was p53 -/-. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD. Oncogene (0950-9232) 2011 imex curation Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Parkinsons - Interactions investigated in the context of Parkinsons disease Cancer - Interactions investigated in the context of cancer wghui@ustc.edu.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fu K., Ren H., Wang Y., Fei E., Wang H., Wang G. Apoptosis - Interactions involving proteins with a function related to apoptosis wghui@ustc.edu.cn Accepted 2011-OCT-28 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD DIP protein Q99497 original sequence version: 102 4B21661B3A76BC67 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F tr10a_human Tumor necrosis factor receptor superfamily member 10A Death receptor 4 TNF-related apoptosis-inducing ligand receptor 1 TNFRSF10A APO2 DR4 TRAILR1 protein protein human Homo sapiens Human MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE 7E96619D0BDC0CD4 park7-fadd 7 9 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range There are three copies of the flag sequence. ecoli Escherichia coli (strain K12) direct interaction direct interaction 4a park7-fadd-1 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range There were three copies of the flag sequence. This tag was used to inmunoprecipitate park7. myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q99497:p.Leu166Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:26:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu166ala' Tue Jun 30 18:32:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu166Ala' physical association physical association 4b fadd-park7-1 2 10 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99497:p.Leu166Pro mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P Wed May 02 17:18:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu166pro' Tue Jun 30 18:11:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu166Pro' physical association physical association 4c fadd-park7-2 5 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4d fadd-park7-4 1 10 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ded domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range There are three copies of the flag sequence in this tag. This is the tag that was used for park7 detection. ecoli Escherichia coli (strain K12) direct interaction direct interaction S1 and 5b casp8-fadd-11 1 10 unspecified role unspecified role prey prey purified purified myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range There are three copies of the falg sequence in this tag. This is the tag used for detection of fadd in this experiment. ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ded domains region experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain There are two DED domains in this region of caspase 8. ecoli Escherichia coli (strain K12) direct interaction direct interaction 5c Co-expression of his-tagged park7 decreases this interaction in a dose-dependent manner. fadd-casp8-4 6 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 competitor competitor competitor prey prey association association 5d and 5e fadd-park7-6 8 9 competitor competitor competitor prey prey 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Treatment of the cells with TRAIL (induces extrinsic apoptosis and DISC complex formation) disrupts the interaction between fadd and park7. tr10a is unaffected by the treatment. Fig. 5H park7-tnfrsf10a 5 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association S2 This interaction is dependent on TRAIL treatment of the cells (induces the extrinsic apoptosis pathway). fadd-casp8-5 4 9 competitor competitor competitor prey prey 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association S3 TRAIL treatment of the cells (induces the extrinsic apoptosis pathway) increases casp8 bindings and diminishes park7 binding. casp8-tnfrsf10a-3 8 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association park7 knock-down increases the interaction. fadd-casp8-6 6 10 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey physical association physical association S5 fadd-casp8-7 6 9 competitor competitor competitor prey prey Q99497:p.Leu166Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:54:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu166pro' Tue Jun 30 15:56:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu166Pro' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined This participant was detected via its HA tag. 10 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey association association 5f and 5g