IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Impairment of Cytoplasmic eIF6 Activity Restricts Lymphomagenesis and Tumor Progression without Affecting Normal Growth. Impairment of Cytoplasmic eIF6 Activity Restricts Lymphomagenesis and Tumor Progression without Affecting Normal Growth. Cancer Cell (1535-6108) 2011 imex curation Miluzio A., Beugnet A., Grosso S., Brina D., Mancino M., Campaner S., Amati B., de Marco A., Biffo S. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer biffo.stefano@hsr.it 23-Sept-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Miluzio A., Beugnet A., Grosso S., Brina D., Mancino M., Campaner S., Amati B., de Marco A., Biffo S. Apoptosis - Interactions involving proteins with a function related to apoptosis biffo.stefano@hsr.it Accepted 2011-AUG-12 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 jyoti Only protein-protein interactions imex curation if6_human Eukaryotic translation initiation factor 6 EIF6 ITGB4BP OK/SW-cl.27 B4 integrin interactor CAB p27(BBP) B(2)GCN homolog EIF3A protein protein human Homo sapiens Human MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT 5BA97CD5DB0C17C3 kpcb_mouse Protein kinase C beta type Prkcb Pkcb Prkcb1 protein protein mouse Mus musculus Mouse MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV A1935030F758513C eif6-pkcbeta_2 1 3 enzyme enzyme neutral component neutral component mouse-lymphoma Mus musculus lymphoma Lymphoma 2 enzyme target enzyme target substrate substrate neutral component neutral component n_terminal_region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5c RACK1 RACK1 could have been entered as an ancillary? - but could not find the species. phosphorylation of eIF6 eif6-pkcbeta_2-1 1 2 enzyme target enzyme target substrate substrate neutral component neutral component n_terminal_region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 enzyme enzyme neutral component neutral component mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] phosphorylation phosphorylation reaction phosphorylation S4b RACK1 phosphorylation of eIF6