IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Possible role of death receptor-mediated apoptosis by the E3 ubiquitin ligases Siah2 and POSH. Possible role of death receptor-mediated apoptosis by the E3 ubiquitin ligases Siah2 and POSH. Mol. Cancer (null) 2011 imex curation Christian P.A., Fiandalo M.V., Schwarze S.R. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about C-terminal tags position and VTP-NTN mutations was given by the author via email. steve.schwarze@uky.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-ppc-1 human prostatic carcinoma cell line PPC-1 ppc-1 human prostatic carcinoma cell line PPC-1 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Christian P.A., Fiandalo M.V., Schwarze S.R. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about C-terminal tags position and VTP-NTN mutations was given by the author via email. steve.schwarze@uky.edu Accepted 2011-AUG-31 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cancer (null) 2011 Only protein-protein interactions imex curation Possible role of death receptor-mediated apoptosis by the E3 ubiquitin ligases Siah2 and POSH. Possible role of death receptor-mediated apoptosis by the E3 ubiquitin ligases Siah2 and POSH. Mol. Cancer (null) 2011 imex curation Christian P.A., Fiandalo M.V., Schwarze S.R. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about C-terminal tags position and VTP-NTN mutations was given by the author via email. steve.schwarze@uky.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Christian P.A., Fiandalo M.V., Schwarze S.R. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about C-terminal tags position and VTP-NTN mutations was given by the author via email. steve.schwarze@uky.edu Accepted 2011-AUG-31 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cancer (null) 2011 Only protein-protein interactions imex curation sh3r1_human E3 ubiquitin-protein ligase SH3RF1 SH3RF1 POSH1 KIAA1494 POSH RNF142 SH3MD2 SH3 domain-containing RING finger protein 1 Plenty of SH3s SH3 multiple domains protein 2 RING finger protein 142 RING-type E3 ubiquitin transferase SH3RF1 protein protein human Homo sapiens Human MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGVEELPSNILLVRLLDGIKQRPWKPGPGGGSGTNCTNALRSQSSTVANCSSKDLQSSQGGQQPRVQSWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDAGECSSAAAQSSTAPKHSDTKKNTKKRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPSFTFPSDVPYQAALGTLNPPLPPPPLLAATVLASTPPGATAAAAAAGMGPRPMAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWFKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPAQKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHNQERPTAAVTPIQVQNAAGLSPASVGLSHHSLASPQPAPLMPGSATHTAAISISRASAPLACAAAAPLTSPSITSASLEAEPSGRIVTVLPGLPTSPDSASSACGNSSATKPDKDSKKEKKGLLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHGRAGSCPVDGDGPVTTAVAGAALAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI DIP protein Q7Z6J0 original sequence version: 99 B3018000F03D0CF1 siah2_human E3 ubiquitin-protein ligase SIAH2 Seven in absentia homolog 2 SIAH2 RING-type E3 ubiquitin transferase SIAH2 protein protein human Homo sapiens Human MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP DIP protein O43255 original sequence version: 131 2D5DD845666EC924 sh3rf1-siah2 2 3 unspecified role unspecified role bait bait Q7Z6J0:p.[Val605Asn;Pro607Asn] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V N certain certain sequence position certain certain certain sequence position certain P N Wed May 02 14:59:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val605asn,pro607asn' Tue Jun 30 18:22:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val605Asn;Pro607Asn]' 19mer spacer region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain sh3-/sh-4 spacer region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association 5a, 5c sh3rf1-siah2-2 1 4 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O43255:p.[His98Ala;Cys101Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:22:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his98ala,cys101ala' Tue Jun 30 16:39:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His98Ala;Cys101Ala]' This mutation disrupts SIAH2 ubiquitin ligase activity. 3 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5b