IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. Human nuclear clusterin mediates apoptosis by interacting with Bcl-XL through C-terminal coiled coil domain. J. Cell. Physiol. (0021-9541) 2011 imex curation Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-pc3m Human PC3M Caucasian prostate adenocarcinoma pc3m Human PC3M Caucasian prostate adenocarcinoma PC-3M was isolated from a liver metastasis produced by the intrasplenic injection of human PC-3 prostate cancer cells into nude mice. PC-3M cells have "Hyperactive Akt" and are PTEN null. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kim N., Yoo J.C., Han J.Y., Hwang E.M., Kim Y.S., Jeong E.Y., Sun C.H., Yi G.S., Roh G.S., Kim H.J., Kang S.S., Cho G.J., Park J.Y., Choi W.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-XL origin confirmed by author via email. jaeyong@gnu.ac.kr Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Cell. Physiol. (0021-9541) 2011 Only protein-protein interactions imex curation q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE p10909-4 Clusterin nCLU CLU APOJ CLI KUB1 Aging-associated gene 4 protein Apolipoprotein J Complement cytolysis inhibitor Complement-associated protein SP-40,40 Ku70-binding protein 1 NA1/NA2 Testosterone-repressed prostate message 2 AAG4 Sulfated glycoprotein 2 protein protein human Homo sapiens Human MSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE Minor isoform that has been detected in a breast cancer cell line, but not in any other tissues or cell lines (Ref.29). Not glycosylated. Not detected in unstressed cells. Detectable at low level in stressed cells (Ref.3). 77900AB70F7AC243 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 clus_human Clusterin CLU APOJ CLI KUB1 Complement-associated protein SP-40,40 Complement cytolysis inhibitor NA1/NA2 Apolipoprotein J Testosterone-repressed prostate message 2 Ku70-binding protein 1 Aging-associated gene 4 protein AAG4 Sulfated glycoprotein 2 protein protein human Homo sapiens Human MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE DIP protein P10909 original sequence version: 151 9583DE4CCECC169F clu-bcl2l1 5 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey physical association physical association Fig. 1e bcl2l1-bax 5 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Overexpressed nClu (P10909-4) disrupted this interaction. 1f bcl2l1-clu-3 2 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 1h bcl2l1-clu-1 1 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 3b clu-bcl2l1-1 4 8 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain leu323ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 3c and 5d clu-bcl2l1-4 1 8 unspecified role unspecified role bait bait P10909-4:p.Ser323Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:38:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser323ala' Tue Jun 30 19:49:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser323Ala' region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5b and 5c clu-bcl2l1-5 3 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 7c clu-bcl2l1-3 6 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association S3b