I2D I2D C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. Oncogene (0950-9232) 2011 imex curation Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer huirutai@sglab.org 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis huirutai@sglab.org Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Human heart cDNA library. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. Oncogene (0950-9232) 2011 imex curation Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer huirutai@sglab.org 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis huirutai@sglab.org Accepted 2011-OCT-12 by ORCHARD Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer. Oncogene (0950-9232) 2011 imex curation Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer huirutai@sglab.org 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Shi Y., Chen J., Li Z., Zhang Z., Yu H., Sun K., Wang X., Song X., Wang Y., Zhen Y., Yang T., Lou K., Zhang Y., Zhang G., Hu Y., Ji J., Hui R. Apoptosis - Interactions involving proteins with a function related to apoptosis huirutai@sglab.org Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF miny3_human Ubiquitin carboxyl-terminal hydrolase MINDY-3 MSTP126 My042 MINDY3 C10orf97 CARP DERP5 Dermal papilla-derived protein 5 Deubiquitinating enzyme MINDY-3 FAM188A Protein CARP protein protein human Homo sapiens Human MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN F30B4A5E357AF52E cops5-fam188a 2 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5b cops5-fam188a-1 3 4 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5c fam188a-cops5 1 5 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association