IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions rat-r3 Rat R3 Schwann cells - neuronal immortalized with SV40 large T antigen. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation EBI-3957474:- No isoform is specificed for this interaction - the other 2 interactions are both isoform 2. Point mutation data:- There are patient mutations in Fig 1E (formerly christened Fig 1D) - maybe this explains it? A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line imaging technique imaging technique microscopy antibody detection identification by antibody antibody detection Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Images were taken under Zeiss Axioskop 2 fluorescence microscope OR Leica TCS SP2 scanning confocal microscope. Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-09_8tl_mpnst Human 09-8TL Malignant schwannoma cell line 09_8tl_mpnst 09-8TL Malignant schwannoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. imaging technique imaging technique microscopy antibody detection identification by antibody antibody detection Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Images were taken under Zeiss Axioskop 2 fluorescence microscope OR Leica TCS SP2 scanning confocal microscope. Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions rat-rt4-67 RT4-67 schwannoma cell line rt4-67 RT4-67 schwannoma cell line constructed from the RT4-DP6 rat schwannoma cells and harbor a tetracycline-inducible allele of NF2. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis not clear (especially for Fig 5E) if Participant det. is anti-tag WB or WB. Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. A Tight Junction-Associated Merlin-Angiomotin Complex Mediates Merlin's Regulation of Mitogenic Signaling and Tumor Suppressive Functions. Cancer Cell (1535-6108) 2011 imex curation Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Yi C., Troutman S., Fera D., Stemmer-Rachamimov A., Avila JL., Christian N., Luna Persson N., Shimono A., Speicher DW., Marmorstein R., Holmgren L., Kissil JL. Apoptosis - Interactions involving proteins with a function related to apoptosis Authors confirm that Amot constructs are Human in origin. The species of Merlin has been inferred from sequence length and mutant mapping data. jkissil@wistar.org Accepted 2011-AUG-30 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation amol2_human Angiomotin-like protein 2 Leman coiled-coil protein AMOTL2 KIAA0989 protein protein human Homo sapiens Human MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGSPQASLEILAPEDSQVLQQATRQEPQGQEHQGGENHLAENTLYRLCPQPSKGEELPTYEEAKAHSQYYAAQQAGTRPHAGDRDPRGAPGGSRRQDEALRELRHGHVRSLSERLLQLSLERNGARAPSHMSSSHSFPQLARNQQGPPLRGPPAEGPESRGPPPQYPHVVLAHETTTAVTDPRYRARGSPHFQHAEVRILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALGNAQGRAARAEEELRKKQAYVEKVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI DIP protein Q9Y2J4 original sequence version: 108 665BE69FD7757CEF e2qzz2_canlf NF2 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEITTKPTYPPMNPIPAPLPPDISSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGTSSKHNTIKKVPSLLSRVIRLLFFMHT DIP protein E2QZZ2 original sequence version: 34 0A30568EF0BC8BCC pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B amot_human Angiomotin AMOT KIAA1071 protein protein human Homo sapiens Human MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQAHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI DIP protein Q4VCS5 original sequence version: 101 D7E7021E9535A628 q68em7-1 Rho GTPase-activating protein 17 ARHGAP17 RICH1 Rho-type GTPase-activating protein 17 RhoGAP interacting with CIP4 homologs protein 1 MSTP066 MSTP110 protein protein human Homo sapiens Human MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGTDAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGPEPPPQSSRAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASGQNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL q4vcs5-2 Angiomotin AMOT p80 KIAA1071 protein protein human Homo sapiens Human MPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI EBC28B74427AD481 rhg17_human Rho GTPase-activating protein 17 ARHGAP17 Rho-type GTPase-activating protein 17 RhoGAP interacting with CIP4 homologs protein 1 MSTP066 MSTP110 RICH1 protein protein human Homo sapiens Human MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGTDAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGPEPPPQSSRAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASGQNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL 92029DBFFEAD1001 q4vcs5-1 Angiomotin p130 AMOT KIAA1071 protein protein human Homo sapiens Human MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQAHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI D7E7021E9535A628 merl_rat Merlin Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomin Nf2 protein protein rat Rattus norvegicus (Rat) Rat IASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERSRDEPERRVLHMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFDIIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHSEHSDSGTSSKHNTIKKPQAQGRRPICI 2385AF8461407B24 pals1_human Protein PALS1 PALS1 MAGUK p55 subfamily member 5 MPP5 Membrane protein, palmitoylated 5 Protein associated with Lin-7 1 protein protein human Homo sapiens Human MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR A3B2CB594E0908CA p35240-3 Merlin II NF2 SCH Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomerlin Schwannomin protein protein human Homo sapiens Human MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQAQGRRPICI 99B732B48367D22A p35240-1 Merlin I NF2 SCH Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomerlin Schwannomin protein protein human Homo sapiens Human MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL DIP protein P35240-1 original sequence version: 177 B1A1BF2BD5DA561C inadl_human InaD-like protein CIPP Channel-interacting PDZ domain-containing protein PATJ INADL Pals1-associated tight junction protein Protein associated to tight junctions protein protein human Homo sapiens Human MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFNSVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLKENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPETVCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLVEDNEEESCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQQKEIEQSKEAWEMHEFLTPRLQEMDEEREILVDEEYELYQDPSPSMELYPLSHIQEATPVPSVNELHFGTQWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPSTEGNSQQGRFDDLENLNSLAKTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQATRVISKASAYTGMLSSRYATDTCELPEREEGEGEETPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMKLPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQMKQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTEEQLQMTAD 313DD1F12B6AD80A q68em7-2 Rho GTPase-activating protein 17 ARHGAP17 RICH1 Rho-type GTPase-activating protein 17 RhoGAP interacting with CIP4 homologs protein 1 MSTP066 MSTP110 protein protein human Homo sapiens Human MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGTDAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMAAATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEGDLVKKESPPKPKDPVSAAVPAPGRNNSQIASGQNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL amol1_human Angiomotin-like protein 1 AMOTL1 protein protein human Homo sapiens Human MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQQGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLPGSGNGKGFKVGGGPSPAQPAGKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYPAPQPVRTDVAVLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQPPPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKSTTKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHFAMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRKDAGKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEHASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLKHPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI DIP protein Q8IY63 original sequence version: 98 6F47AE3A13816E95 merl_human Merlin Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomin Schwannomerlin NF2 SCH protein protein human Homo sapiens Human MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL B1A1BF2BD5DA561C d4a9q2_rat Amot protein protein rat Rattus norvegicus (Rat) Rat MRNSEDQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNSSPFSTGSGNPVPQNDVLSSQDHHQQLVAHPARQEPQGQEIQSENGVMEKQVSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLTPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPPPSQHSLKSMEHRGPPPEYPFKGVPSQSVVCKSQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARATQDIASLSFSARNSQPHSPTSSLTAGAASLPLLQSPPSTRLSSGQHGLVSNQGDHSAHLPRHQQHLLPNQSHQGDHYRHPQPSLTPAQQQPGEAYSAMPRAQQAAAYQPMPADPFAIVSRAQQMVEILSDENRNLRQELDGCYEKVARLQKVETEIQRVSEAYETLVKSSSKREALEKAMRNKLEGEIRRMHDFNRDLRDRLETANKQLAEKEYEGSEDTRKTISQLFAKHKENQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNSQPTNASEYNAAALMELLREKEERILALEADMTKWEQKYLEENNVMRHFALDAAATVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSSMRPAKSLMSISNAGSGLLVHSSTLTGVPIMEEKRDDKSWKGSLGILLGGDYRAEPVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERGSESTKTAAVTPISVPMAGPVAAAAPAAAINATAATNTATAATNTTIMVAAAPVAVAAAAAPAAATATPSPANAAALAAAAAAAVTPATPVSAATSVSAATSISQAAPVSPAAPVSPAAPVSPAAAGQIAVAASLTSATVSPTPAAATAAGAAAGAAVATVAAAATTTAIQVAPATSAPVPSPASIPAPATAQASAPTPTQASTPAPIEPPTAVPTPTPALVQAEGPASPGASSGPRRLSTPNLMCNPDKPDGPAFHSSTLERKTPIQILGQEPDAEMVEYLI 01FD91E6C274ABB4 q4vcs5_1-nf2 2 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey physical association physical association Fig 1A. amot-nf2-2 5 15 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association Fig 1F amot-nf2-5 9 15 unspecified role unspecified role neutral component neutral component 27 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 2A e2qzz2-q4vcs5_1 3 13 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2D overexpression of p80 angiomotin without the TJ-tethering domain resulted in a significant shift of Merlin from cell junctions to perijunctional regions in the cytoplasm. q68em7_1-amot 6 27 unspecified role unspecified role ancillary ancillary region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig S4B. coexpression of Merlin reduced the binding of Rich1 isoform 2 (Q68EM7-2) to Angiomotin, to a larger extent than Rich1 isoform 1 (Figure S4B). arhgap17-q4vcs5_1 6 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S4A. Both isoforms of Amot bind to Rich-1. amot-arhgap17-1 8 27 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4B, 4C, 4E. the amount of Myc-Rich1 coprecipitated with Angiomotin was drastically diminished when HA-Merlin was coexpressed . fig 4D will need adding - mutants if author repies... sparsely grown cells (Sp) or cells grown in suspension (Su) show reduced interactions between both Angiomotin-Merlin and Angiomotin-Rich1. However, serum starvation followed by brief exposure to serum (St) dissociates Merlin from Angiomotin, while increasing the amount of Angiomotin-bound Rich1. NF2 Competes with ARHGAP17 for Association with AMOT d4a9q2-arhgap17 10 28 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5D. Doxycycline-induced expression of Merlin in RT4-67 cells leads to a gradual decrease in Angiomotin/Rich1 association. (Fig 5D) amot-arhgap17-2 10 27 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5E. The Angiomotin/Merlin complex, which is disrupted upon serum stimulation (St), leads to an increase in Angiomotin/Rich1 association (Figure 5E). amot-nf2-6 7 27 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig S4F amot-nf2-14 1 28 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association Fig S4F nf2-amot-8 11 26 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey association association Fig S1A/C amot-2-merl 2 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait cc_domains required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1A, S1D. amot-inadl 6 17 unspecified role unspecified role bait bait c-term_pdz-eyli_motif required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S1D. amot-e2qzz2 3 13 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig 2D overexpression of p80 angiomotin without the TJ-tethering domain resulted in a significant shift of Merlin from cell junctions to perijunctional regions in the cytoplasm. rich1-amot 6 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S4A. Both isoforms of Amot bind to Rich-1. amot-arhgap17-3 6 27 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4A. amot-nf2-8 6 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role bait bait n terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 1C/D amot-nf2-10 6 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 1C/D nf2-amot-4 2 27 unspecified role unspecified role bait bait P35240:p.Arg346Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R S Wed May 02 16:15:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg346ser' Tue Jun 30 18:48:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg346Ser' P35240:p.Glu463Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E K Wed May 02 18:26:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu463lys' Tue Jun 30 16:11:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu463Lys' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey physical association physical association Fig 1E Mutated proteins derive from allleles of patients developing Neurofibromatosis Type 2. amot-nf2-12 4 27 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1G, S1K, S4C. nf2-amot-6 10 28 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 5A doxycycline (a semi-synthetic tetracycline antibiotic) amot-nf2-13 10 20 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association Fig 5A doxycycline (a semi-synthetic tetracycline antibiotic) inadl-nf2-1 6 24 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S1E IP of Patj-Myc fails to pull down Flag-Merlin when Angiomotin is knocked down. mpp5-amot 6 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S1E Merlin requires the coexpression of both Angiomotin and Patj to coprecipitate with Pals1. nf2-pak1 6 27 unspecified role unspecified role bait bait reg flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S1H nf2-amot-7 4 27 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig S1K. q68em7_2-q4vcs5-2 6 25 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S4B. coexpression of Merlin reduced the binding of Rich1 isoform 2 (Q68EM7-2) to Angiomotin, to a larger extent than Rich1 isoform 1 (Figure S4B). arhgap17-amot-5 4 15 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction S4D nf2-amot-9 6 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 27 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A. arhgap17-amot-6 6 18 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A. amot-arhgap17-4 6 18 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig 4A.