IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol. Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol. Cell (0092-8674) 2011 imex curation Edlich F., Banerjee S., Suzuki M., Cleland MM., Arnoult D., Wang C., Neutzner A., Tjandra N., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Fluorescence Loss in Photobleaching, or FLIP - molecule is labelled with a fluorescent dye, and a bleached by confocal laser scanning microscope. The fluorescence intensity is measured over time. Species of origin of the constructs supplied by the author. youle@helix.nih.gov 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 fluorescence fluorescence technology fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence Edlich F., Banerjee S., Suzuki M., Cleland MM., Arnoult D., Wang C., Neutzner A., Tjandra N., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Fluorescence Loss in Photobleaching, or FLIP - molecule is labelled with a fluorescent dye, and a bleached by confocal laser scanning microscope. The fluorescence intensity is measured over time. Species of origin of the constructs supplied by the author. youle@helix.nih.gov Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol. Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol. Cell (0092-8674) 2011 imex curation Edlich F., Banerjee S., Suzuki M., Cleland MM., Arnoult D., Wang C., Neutzner A., Tjandra N., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Fluorescence Loss in Photobleaching, or FLIP - molecule is labelled with a fluorescent dye, and a bleached by confocal laser scanning microscope. The fluorescence intensity is measured over time. Species of origin of the constructs supplied by the author. youle@helix.nih.gov 26-Sep-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Edlich F., Banerjee S., Suzuki M., Cleland MM., Arnoult D., Wang C., Neutzner A., Tjandra N., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Fluorescence Loss in Photobleaching, or FLIP - molecule is labelled with a fluorescent dye, and a bleached by confocal laser scanning microscope. The fluorescence intensity is measured over time. Species of origin of the constructs supplied by the author. youle@helix.nih.gov Accepted 2011-JUL-01 by JYOTI 26-Sep-2011: Contacted by JYOTI. Cell (0092-8674) 2011 jyoti Only protein-protein interactions imex curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bcl2l1-bax 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 direct interaction direct interaction Supp. Fig. 2C Interaction only occurs in the presence of detergents - any one of Triton X-100, Triton X-114, CHAPS, dodecyl maltoside, Tween 20, W-1, sodium deoxycholate, octyl glucoside or NP-40. When constrined in it inactive conformation, BAX is less likely to bind to BCL-XL. bax-bcl2l1 1 3 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q07812:p.Asp68Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R Wed May 02 18:12:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp68arg' Tue Jun 30 18:36:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp68Arg' 5 unspecified role unspecified role neutral component neutral component Q07817-1:p.Gly138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:28:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly138ala' Tue Jun 30 16:19:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly138Ala' colocalization colocalization Figs 4B-E, 6A-B, D-G Supp. Fig. 4B-D, 4F Bcl-2/Bcl-xL inhibitor ABT-737 bax-bcl2l1-2 1 5 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component colocalization colocalization Figs 4B-E, 6B, D-G Supp. Fig. 4B-D, 4F Bcl-2/Bcl-xL inhibitor ABT-737 bax-bcl2-3 1 3 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 6A bax-mcl1 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 6A