InnateDB InnateDB Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Nat. Immunol. (1529-2908) 2011 imex curation Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org 06-Jun-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 mgt Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Nat. Immunol. (1529-2908) 2011 imex curation Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org 06-Jun-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 mgt Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Nat. Immunol. (1529-2908) 2011 imex curation Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org 06-Jun-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 mgt Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Intracellular MHC class II molecules promote TLR-triggered innate immune responses by maintaining activation of the kinase Btk. Nat. Immunol. (1529-2908) 2011 imex curation Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org 06-Jun-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-macrophage Mus musculus macrophage macrophage Macrophage confocal microscopy confocal microscopy immunostaining immunostaining Liu X., Zhan Z., Li D., Xu L., Ma F., Zhang P., Yao H., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis macrophages derived from MHC class II KO and wt mice caoxt@immunol.org Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 mgt Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity myd88_mouse Myeloid differentiation primary response protein MyD88 Myd88 protein protein mouse Mus musculus Mouse MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP DIP protein P22366 original sequence version: 131 DIP protein P22366 original sequence version: 141 DIP protein P22366-1 original sequence version: 143 DIP protein P22366-1 original sequence version: 144 DIP protein P22366 original sequence version: 122 393A75C3723FFE69 irak1_mouse Interleukin-1 receptor-associated kinase 1 Pelle-like protein kinase Irak1 Il1rak protein protein mouse Mus musculus Mouse MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTKSSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQLHLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAGQRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS DIP protein Q62406 original sequence version: 122 DIP protein Q62406 original sequence version: 98 8A501F002CD3EBD2 tcam1_mouse TIR domain-containing adapter molecule 1 Ticam1 Trif Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta protein protein mouse Mus musculus Mouse MDNPGPSLRGAFGILGALERDRLTHLKHKLGSLCSGSQESKLLHAMVLLALGQDTEARVSLESLKMNTVAQLVAHQWADMETTEGPEEPPDLSWTVARLYHLLAEENLCPASTRDMAYQVALRDFASQGDHQLGQLQNEAWDRCSSDIKGDPSGFQPLHSHQGSLQPPSASPAVTRSQPRPIDTPDWSWGHTLHSTNSTASLASHLEISQSPTLAFLSSHHGTHGPSKLCNTPLDTQEPQLVPEGCQEPEEISWPPSVETSVSLGLPHEISVPEVSPEEASPILPDALAAPDTSVHCPIECTELSTNSRSPLTSTTESVGKQWPITSQRSPQVPVGDDSLQNTTSSSPPAQPPSLQASPKLPPSPLSSASSPSSYPAPPTSTSPVLDHSETSDQKFYNFVVIHARADEQVALRIREKLETLGVPDGATFCEEFQVPGRGELHCLQDAIDHSGFTILLLTASFDCSLSLHQINHALMNSLTQSGRQDCVIPLLPLECSQAQLSPDTTRLLHSIVWLDEHSPIFARKVANTFKTQKLQAQRVRWKKAQEARTLKEQSIQLEAERQNVAAISAAYTAYVHSYRAWQAEMNKLGVAFGKNLSLGTPTPSWPGCPQPIPSHPQGGTPVFPYSPQPPSFPQPPCFPQPPSFPQPPSFPLPPVSSPQSQSFPSASSPAPQTPGPQPLIIHHAQMVQLGVNNHMWGHTGAQSSDDKTECSENPCMGPLTDQGEPLLETPE DIP protein Q80UF7 original sequence version: 82 DIP protein Q80UF7 original sequence version: 83 DIP protein Q80UF7 original sequence version: 81 2EAC87F1936B7C83 btk_mouse Tyrosine-protein kinase BTK Bruton tyrosine kinase B-cell progenitor kinase Kinase EMB Btk Bpk Agammaglobulinemia tyrosine kinase protein protein mouse Mus musculus Mouse MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES E502B798BC36E223 tnr5_mouse Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 Cd40 Tnfrsf5 protein protein mouse Mus musculus Mouse MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV DIP protein P27512 original sequence version: 122 C7970DAD2FEA534A tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9WUN2 original sequence version: 53 DIP protein Q9WUN2 original sequence version: 101 DIP protein Q9WUN2 original sequence version: 100 DIP protein Q9WUN2 original sequence version: 93 978ADDE3061DACD1 myd88-irak1 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 4D LPS (0-90mins) interaction is reduced in MHC class II deficient murine macrophages ticam1-tbk1 3 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 4E LPS (0-90mins) interaction is reduced in MHC class II deficient murine macrophages btk-myd88-1 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Fig. 7A LPS (15-90mins) interaction reduced in MHC class II deficient murine macrophages btk-cd40 3 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. S12A LPS (5-15mins) btk-cd40-1 4 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 6E LPS(15mins) btk-tcam1 1 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7B btk-myd88-5 1 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7B btk-cd40-2 2 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind range range range range 9 unspecified role unspecified role prey prey physical association physical association Fig. S12C LPS (15mins)