IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Free Radic. Biol. Med. (0891-5849) 2011 imex curation Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha confocal microscopy confocal microscopy immunostaining immunostaining Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Free Radic. Biol. Med. (0891-5849) 2011 imex curation Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Human origin of Cav-1 in fig 2b stated by author upon request. yjin@rics.bwh.harvard.edu Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. Free Radic. Biol. Med. (0891-5849) 2011 imex curation Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions mouse-lung Mus musculus lung anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu Accepted 2011-AUG-22 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF fadd_mouse FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity Fadd Mort1 protein protein mouse Mus musculus Mouse MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHTGLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP DIP protein Q61160 original sequence version: 78 DIP protein Q61160 original sequence version: 97 DIP protein Q61160 original sequence version: 133 DIP protein Q61160 original sequence version: 139 4BC8D86B33A58783 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 casp8_mouse Caspase-8 Casp8 protein protein mouse Mus musculus Mouse MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP DIP protein O89110 original sequence version: 82 DIP protein O89110 original sequence version: 143 DIP protein O89110 original sequence version: 151 045268AE3DE5ED4F fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 tnr6_mouse Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen protein protein mouse Mus musculus Mouse MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE DIP protein P25446 original sequence version: 112 D8DA95CA525CED56 tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 fas-casp8-3 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 2a The interaction occurs only under hyperoxia conditions. Cav-1 (P49817) is also required. fas-fadd-4 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2b Hyperoxia conditions were required for the interaction. Overexpression of Cav-1 (Human or mouse??) greatly increased the interaction. cav1-fas 1 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 3a Hyperoxia conditions are required for the colocalization to occur. cav1-fas-2 2 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3b and 4b Short-term hyperoxia conditions (4h) increased the interaction detected in whole cell lysates and in lipid raft fractions. After long term exposure to hyperoxia (12-24 h), the increase was only present in the lipid raft fraction of the cell (fig. 3b). Palmitoylation is required for the interaction to happen. The presence of 2-bromopalmitic acid, inhibitor of palmitoylation, decreases the interaction (fig. 4b). fas-fas 2 10 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 3c Multimerization of FAS, with no explicited stochioimetry, was monitored in this experiment. fas-cav1 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4a Hyperoxia conditions are required for the interaction to happen. The presence of N-acetylcysteine, a ROS scavenger molecule, decreases the interaction, pointing out a ROS-mediated mechanism of action for the hyperoxia to induce the interaction. bid-cav1 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 5c Hyperoxia conditions are required for the colocalization to occur. cav1-bid 2 6 unspecified role unspecified role bait bait Q03135:p.Tyr14Phe mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 17:40:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr14phe' Tue Jun 30 20:24:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr14Phe' 4 unspecified role unspecified role prey prey physical association physical association 5d Hyperoxia conditions are required for the interaction to happen. bid-cav1-1 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 6c Hyperoxia conditions are required for the interaction to happen. Catalase (P04040) was found to be an agonist of the interaction. Glutathion peroxidase 2 (P18283) was found to be an antagonist of the interaction.