Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com CIDEA interacts with liver X receptors in white fat cells. CIDEA interacts with liver X receptors in white fat cells. FEBS Lett. (0014-5793) 2011 imex curation Kulyte A., Pettersson AT., Antonson P., Stenson BM., Langin D., Gustafsson JK., Staels B., Ryden M., Arner P., Laurencikiene J. Apoptosis - Interactions involving proteins with a function related to apoptosis Participant detection method taken from back reference- PMID: 10681503 Jurga.Laurencikiene@ki.se 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions curated by molecular connections pvt. ltd. in vitro In vitro pull down pull down autoradiography autoradiography Kulyte A., Pettersson AT., Antonson P., Stenson BM., Langin D., Gustafsson JK., Staels B., Ryden M., Arner P., Laurencikiene J. Apoptosis - Interactions involving proteins with a function related to apoptosis Participant detection method taken from back reference- PMID: 10681503 Jurga.Laurencikiene@ki.se Accepted 2011-JUL-26 by MGT 26-Sep-2011: Contacted by JYOTI. FEBS Lett. (0014-5793) 2011 mgt Only protein-protein interactions imex curation curated by molecular connections pvt. ltd. nr1h2_human Oxysterols receptor LXR-beta Ubiquitously-expressed nuclear receptor Nuclear receptor NER Liver X receptor beta Nuclear receptor subfamily 1 group H member 2 NR1H2 LXRB NER UNR protein protein human Homo sapiens Human MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE DIP protein P55055 original sequence version: 120 DIP protein P55055 original sequence version: 153 9465A6FFB7FCFD2F cidea_human Cell death activator CIDE-A Cell death-inducing DFFA-like effector A CIDEA protein protein human Homo sapiens Human MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG 05F704823CE71C0E nr1h2-cidea-1 1 3 unspecified role unspecified role prey prey 35s-cys-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 2 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction fig. 2a