IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ARTS and Siah collaborate in a pathway for XIAP degradation. ARTS and Siah collaborate in a pathway for XIAP degradation. Mol. Cell (1097-2765) 2011 imex curation Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu,reedoffice@burnham.org 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu; reedoffice@burnham.org ducg@ucmail.uc.edu,reedoffice@burnham.org Accepted 2011-AUG-23 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2011 Only protein-protein interactions imex curation ARTS and Siah collaborate in a pathway for XIAP degradation. ARTS and Siah collaborate in a pathway for XIAP degradation. Mol. Cell (1097-2765) 2011 imex curation Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu,reedoffice@burnham.org 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu; reedoffice@burnham.org ducg@ucmail.uc.edu,reedoffice@burnham.org Accepted 2011-AUG-23 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2011 Only protein-protein interactions imex curation ARTS and Siah collaborate in a pathway for XIAP degradation. ARTS and Siah collaborate in a pathway for XIAP degradation. Mol. Cell (1097-2765) 2011 imex curation Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu,reedoffice@burnham.org 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu; reedoffice@burnham.org ducg@ucmail.uc.edu,reedoffice@burnham.org Accepted 2011-AUG-23 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2011 Only protein-protein interactions imex curation ARTS and Siah collaborate in a pathway for XIAP degradation. ARTS and Siah collaborate in a pathway for XIAP degradation. Mol. Cell (1097-2765) 2011 imex curation Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu,reedoffice@burnham.org 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garrison J.B., Correa R.G., Gerlic M., Yip K.W., Krieg A., Tamble C.M., Shi R., Welsh K., Duggineni S., Huang Z., Ren K., Du C., Reed J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis ducg@ucmail.uc.edu; reedoffice@burnham.org ducg@ucmail.uc.edu,reedoffice@burnham.org Accepted 2011-AUG-23 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell (1097-2765) 2011 Only protein-protein interactions imex curation xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 siah1_human E3 ubiquitin-protein ligase SIAH1 Seven in absentia homolog 1 Siah-1a SIAH1 HUMSIAH RING-type E3 ubiquitin transferase SIAH1 protein protein human Homo sapiens Human MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC DIP protein Q8IUQ4 original sequence version: 132 FA0698D0DC1B0A15 sept4_human Septin-4 SEPTIN4 ARTS Apoptosis-related protein in the TGF-beta signaling pathway Bradeion beta Brain protein H5 CE5B3 beta Cell division control-related protein 2 Cerebral protein 7 PNUTL2 Peanut-like protein 2 SEP4 SEPT4 hucep-7 C17orf47 protein protein human Homo sapiens Human MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY 2F08D3611EF6523D o43236-6 Septin-4 SEPTIN4 ARTS Apoptosis-related protein in the TGF-beta signaling pathway Bradeion beta Brain protein H5 CE5B3 beta Cell division control-related protein 2 Cerebral protein 7 PNUTL2 SEP4 Peanut-like protein 2 SEPT4 hucep-7 SEPT4_i2 C17orf47 protein protein human Homo sapiens Human MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH May be defective in GTP-binding. 7FA8D55492E9348F sept4-siah1-2 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2b This endogenous proteins interaction is dependent on MOMP (Mitochondrial Outer Membrane Permeabilization). siah1-xiap 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 2c This endogenous proteins interaction is dependent on MOMP (Mitochondrial Outer Membrane Permeabilization). sept4-xiap-1 4 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir1 domain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1a and S1b xiap-sept4 2 5 unspecified role unspecified role bait bait purified purified bir1 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bir3 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain AVPI (a SMAC mimetic) was required for the interaction of SEPT4 (ARTS) with the BIR3 domain of XIAP to happen. ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 1b sept4-xiap-2 4 9 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a sept4-siah1-3 4 9 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a xiap-siah1 4 5 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2d SEPT4 (ARTS) presence is required for the interaction to happen, as well as MOMP (Mitochondrial Outer Membrane Permeabilization) conditions (via STS treatment). sept4-siah1-4 4 9 unspecified role unspecified role bait bait O43236-6:p.[Val42Ala;Glu44Ala;Arg46Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain V A Fri Jul 22 10:52:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg46ala,glu44ala,val42ala' Wed May 02 15:15:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val42ala,glu44ala,arg46ala' Tue Jun 30 17:35:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val42Ala;Glu44Ala;Arg46Ala]' O43236-6:p.[Pro40Ala;Val42Ala;Glu44Ala;Arg46Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain P A Fri Jul 22 11:03:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg46ala,glu44ala,val42ala,pro40ala' Wed May 02 20:01:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro40ala,val42ala,glu44ala,arg46ala' Tue Jun 30 18:56:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro40Ala;Val42Ala;Glu44Ala;Arg46Ala]' myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b, 3d, 3e and 3f SEPT4 (ARTS) presence is required for the interaction to happen, as well as MOMP (Mitochondrial Outer Membrane Permeabilization) conditions (via STS treatment). Synthetic SEPT4 peptide (ASRPQVPEPRPQ) disrupted the interaction when delivered either in the cell lysate or when introduced in the cells before lysis via a HIV TAT-signal. xiap-siah1-1 4 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3c wt-SEPT4 (ARTS) presence or MOMP (Mitochondrial Outer Membrane Permeabilization) conditions (via STS treatment) are required for the interaction to happen. mut4-SEPT4 (R46A; E44A; V42A; P40A) presence disrupted the interaction induced by MOMP (Mitochondrial Outer Membrane Permeabilization) conditions (via STS treatment). diablo-xiap-1 1 5 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S1a AVPI (dioablo mimetic) disrupts the interaction. xiap-sept4-1 4 5 unspecified role unspecified role bait bait bir1 domain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S5c