IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage. Cancer Cell (1535-6108) 2010 imex curation Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zeng X., Sigoillot F., Gaur S., Choi S., Pfaff KL., Oh DC., Hathaway N., Dimova N., Cuny GD., King RW. Apoptosis - Interactions involving proteins with a function related to apoptosis I am not sure Fig 2A/b/c shows any interactions? the 3H-TAME could be binding to any of the APC components + other proteins brought down by anti-cdc27. (However in any IP you dont know if you are detecting(WB) an interactor or other members of a complex...) Xenopus interphase egg extract. Authors confirm Xenopus laevis as the species used, and that recombinant Cdh1 is also X.laevis. They also confirm that entry used for X. laevis "cdc20" is Q6DFD4 -loc398044 protein. randy_king@hms.harvard.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation q6dfd4_xenla cdc20.L LOC398044 cdc20 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAQFAFETDINSILKLDTPITNAPLARWQRKAKEGNCSSLNTSANTSTLSPMKASNRSHSSSKTPSKTPGKSGPKMQGTPSRAGGDRFIPNRSAMQMDVASFLLCKENEPVDTSPTKKEQQKAWAMNLNGFDMEEAKILRLGGRPQNAPEGYQNNLKVLYSQKTTPGSSKKTGRYIPSMPDRVLDAPDIRNDYYLNLIDWSSQNALAVALNDSVYLWNYATGDIILLLQMENSEEYISSVSWIKEGNYLAVGSSNAEVQLWDVQQQKRLRNMISHSSRVGALNWNNHILSSGSRTGHIHHHDVRVAQHHVSTLAGHTQEVCGLKWSPDGRYLASGANDNLVNVWPCVQGDSGEFSPVQTFTQHQAAVKAVAWCPWQSNVLATGGGTSDRHLRIWNVCSGTCLNSVDTHSQVCSIVWSTNYKELISGHGFAQNQLVLWKYPTMTRVTELKGHTARVLNLAMSPDGCTVASAAADETLRLWKCFEVDPVTKKEKEKARSSKSIIHQSIR 12ADA4530FF5B303 cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 q6nu36_xenla Anaphase-promoting complex subunit 4 anapc4.L Cyclosome subunit 4 MGC81278 anapc4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPPFRQVGEKQLPHEIIFLAWSPKRDLIALVNKAGEVLLHRLANIQRVWSLPPNENTGKEVTCLAWRPDGKILAFGLADTKKVILCDVEKPESLHSFSLETPISCMQWMEVNVENSVLTSFYNAEDEANVLLPKLPALPKNYTATAKIFSEEKSDEILKLLGDARLNALVLGGDSGQIEIYAYGMYKIATISEVYGSCLRLCLSSDLKSLSVVTELTTNNTPEITYFQLDTSLLSDYLPEVTRMARKFTHISTLLQYLQLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSVQDEFMQLLLWGKASPELQALLMNQLTVKGLKKLGQSVESSYSTIQKLVISHLQSGAEALLYHLSELKGMALWRQKYEPLGLDAKAIEDAITAVGSFILKAHELLQVIDSGMKNFKAFFRWLYVAMLRMSEDHVLPELNKMTQKDITFVADFLTEHFNEAPDMYNQKGKYFNVERVGQYLKDEDDILMSPPNIEGNQWFSFLQSSTHLKESPLLFPYYPEKSLHFVKRQMEAIIDRCLTKPAQIIGASVQQKRCLPLYQVSASEEACPRLISLPYLWNDKSQNLHCVMFRMLESSSSKVFILRQPTDLSRSINEALLAVTIGNSLNSSAAEDTETSSYSCLDARFYDEDIITVVLRDNSEPEGKDRVLSQLSLSQLYSDEETEDEFTWDTSKRLEEQHSDIPTRTVFLENQGRLLENMKAHYVSVNGIRKVACVLSSNLRHVRVFEMDAEDDGEEEEEEILHSQDVTEEEEEFIQSVDEGQNNSAEAVDVTEESLDS CF694006BE0EC904 q6ddx5_xenla anapc7.L anapc7 anapc7-prov XELAEV_18007839mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEMFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALTKTSKVRPATGNAAATPQNQCLPSEIEVKYKMADCYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERSAVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTLNVIQSIPNLDWLSAWIKAYAFVHTGDNTRAINTICSLEKKSLLRDNVDLLGTLADLYFRVGDNKNAILKFEQAQMLDPYLIKGMDIYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYTKRHSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCCEGLIECYLASSSVREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALIQRPDYIKAVVKKAELLSREQKYDEGIALLRNTLANQSDCVLHRMLGDFLVVVNEFQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEPWFAMQ 98C2D4FE2D3D68ED bub1b_human Mitotic checkpoint serine/threonine-protein kinase BUB1 beta MAD3/BUB1-related protein kinase Mitotic checkpoint kinase MAD3L SSK1 BUB1B BUBR1 MAD3L Protein SSK1 protein protein human Homo sapiens Human MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ DIP protein O60566 original sequence version: 106 DIP protein O60566 original sequence version: 130 DIP protein O60566-1 original sequence version: 119 DIP protein O60566-1 original sequence version: 154 DIP protein O60566 original sequence version: 154 F7871103A56E6B46 cadh1_xenla Cadherin-1 cdh1 Epithelial cadherin Uvomorulin xTCAD-1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MGLKRPWLLGAVVLLTLIQVQGGLAEWTQCRMGFSKEKYSFLVPKNLETDKALGRVIFNSCEGPVRIQFASKDPNFEIHKDGTVYIKNPAKMKDNRKTFRVLAWETKGHVYSTNITLKREGHRHRQDLFSGKHSHHPKSETGLKRQKRDWVIPPIIVSENEKGPFPKRIVQIKSSYAKEVKVYYSITGQGADTPPEGVFAIGREDGWLNVTRPLDREAIDNYVLFSHAVSSNGANVEDPMEIIIKVQDQNDNDPVFTQSVFEGSVPEGSKPGTAVMTVSATDADDSVDMYNGVITYSILNQEPKEPTNKMFTIHSESGLISVLTTGLDREKNPVYTLTIQAADGEFGKDRTTTATALIVVMDTNDNPPVFDPTQYTAKVPENEVGYEVARLTVTDEDIEGTDAWNAVYKIIKGNEANYFSIQTDTGNIGLLKTVKGLDYELKKQYILSVIVTNKANFSVPLQTSTATVTVSVEDVNEAPIFLPPVKEVSVSEDLPSGQVVATYTAQDPDKEQNQKITYVIGNDPAGWVSVNKDNGIVTGNGNLDRESKFVLNNTYKVIILAADSGSPSATGTGTLVLNLLDVNDNGPFLEPQQESFCQKDPGFRVFTIIDRDLSPNTYPYKAELTGESNENWTAIVTGQSILELRPKKELEIGQYDVMITLLDSFGLSNVTKLHITICQCDGDKMQCEEKAAIAGGLGISAIVGILGGILALLLLLLLLLLFVRRKKVVKEPLLPPEDETRDNVFSYDEEGGGEEDQDFDLSQLHRGLDARPDVIRNDVAPVLAAPQYRPRPANPDEIGNFIDENLNAADNDPTAPPYDSLLVFDYEGSGSEAASLSSLNSPNSDLDQDYSALNDWGPRFTKLADMYGGDED 08637967EEFB4664 q6gq04_xenla cdc27.S MGC80529 cdc27 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKAHSCTTPQCKYLLAKCCVDLGKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSLLGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDAEQTFKLTSLQSFSNCVPNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNIKYPLNSDSSISYIDPGVISPDSLPLGTGNAILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQSYNSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGGTQTNLNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGYAYAFTLLGHEFVLTEELDKALACFRNSIRVNSRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYKLALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF DIP protein Q6GQ04 original sequence version: 70 F3E4E06D8CB53604 3h-tame Tritiated TAME :N -alpha-tosyl-L-arginine methyl ester small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tosyl -L -arginine methyl ester tosyl -L -arginine methyl ester c_term_peptide C-FSKTRSTKESVSVLNLFTRIR protein protein chemical synthesis Chemical synthesis (Chemical synthesis) CFSKTRSTKESVSVLNLFTRIR An amino acid sequence which is not represented in UniProt 94E9451A476D5295 cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA apc1_xenla ANAPC1 Xenopus laevis protein protein xenla Xenopus laevis (African clawed frog) African clawed frog An amino acid sequence which is not represented in UniProt no gene model available in xenbase or any other database, let alone any protein. However, for X. tropicalis a gene model does exist. c6ziw0_xenla protein protein xenla Xenopus laevis (African clawed frog) African clawed frog LAAPRPTTGESVVEADLKTALEVLHLYDLHSMVEEWFTEVLQMDLQRNIAPEFWNGINQHENAVEEEQCVVLLLDAFRLLMSRLDPYLRSLDILGRWIDTGLLVSSDSQMLRDKVYTMFKAILFFSTSKNFQDMIQQFYSRTFKIYMKQKKKADDSGSDCDSSMNENEHESDSDDRGGDDAECPGCQSNRDQCWCLCAMEQFQQLSNIFHRLNLLERVCSDAVTTILHKMIEERMEKKCRGEYERSFLGEFQEWIEKVIGWLSKVFLQDGTVPPTTPETSCTLKRWRCHVQRFFYRLYASMRIEELFNIIRDFPESKPAMK 471C3DC39B4B0C28 cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR DIP protein Q12834 original sequence version: 132 DIP protein Q12834 original sequence version: 74 DIP protein Q12834 original sequence version: 100 DIP protein Q12834 original sequence version: 118 DIP protein Q12834 original sequence version: 125 DIP protein Q12834 original sequence version: 114 DIP protein Q12834 original sequence version: 147 DIP protein Q12834 original sequence version: 162 FD5C967AF84089E8 q6dfi7_xenla cdc16.L cdc16 cdc16-prov XELAEV_18012976mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHALRSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFEKSLKEDLKEPSGEWQMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEKELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETLIPESADGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSWFAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAEKWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTYSAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSDAYIGTEIKDKLRCYDFDVHTMKTLKNIISPPWEEREFDFERQSLDESGIMALETSNLLPKSSDTRSPIEEALEIEMNESDMMLETSMSDHST DIP protein Q6DFI7 original sequence version: 38 8BEC989BCF0C78DF q0ih16_xenla Anaphase-promoting complex subunit 5 anapc5.L anapc5 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKISVLVLLSEMSKNTKISLVEKRRLNKQILPLLQGPDMTLSKLIKIVEECCPNVSSSVHIRIKLMAEGELKDMEQFFDDLADSFTGTEPEVHKTSVVGLFLRHMILAYNKLSFSQVYKLYTSLQQYFQSEKSKATSKTDSDEADMDLTNNDEEEGKLEKEDLDFPIGEDDLACSGPLSQKQAEYFLSQQASLMKSDENKALTPVLLQKELNNLLKFNPDFAEAHYLSYLNSLRVQDVFSSTHSLLHYFDRLILTGAESKSNGDEGYGRSLRYAALNLAALHCRFGH 78429A6F759DD34C md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND DIP protein Q13257 original sequence version: 133 DIP protein Q13257 original sequence version: 78 DIP protein Q13257 original sequence version: 105 DIP protein Q13257 original sequence version: 120 DIP protein Q13257 original sequence version: 127 DIP protein Q13257 original sequence version: 116 DIP protein Q13257 original sequence version: 150 DIP protein Q13257 original sequence version: 156 DIP protein Q13257 original sequence version: 134 B8DCBF0043836764 q7t0n9_xenla cdc23.L cdc23 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAATIGMFSDLKEIKRQLLSVTWLCRERGLMNSVKWASELAFSLESVPLNELPSTPALTEEDAQDLDAYMLAKSYFDLKEYDRAAYFLRGCKSQKAYFMYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALREVRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHVLPLHWGTWLELCNLITDKEMLKFLSLPDSWIKEFFLAHIYTELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSYLAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIYSCGEIVEHQEVSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRNQSESPSAEPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP AF133D82C9C52118 cdc27-cdh1 5 16 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 1E. TAME - a small molecule inhibitor of the APC cdc27-3h-tame 6 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A, 2B, S2A. Binding of 3H-TAME correlated with the amount of immunoprecipitated Cdc27. Unlabeled TAME competes with 3H-TAME. cdc27-h3tame 3 20 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 2C. TAME binds to human APC. cdh1-cdc27 8 19 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Fig 2E. Blasting the stated sequence of the Cdh1 C-terminal peptide shows it does not correspond to the C terminal sequence for Xenopus Laevis Cdh1, however, it does correspond to the C terminus of Chicken Cdh1 and the C terminus of Xenopus Fizzy-related protein (fzr1). I dont know quite what add as the short-label for this peptide - certainly NOT "cdh1" The peptide lacking the C-terminal isoleucine and arginine residues binds only weakly to cdc27. TAME n_cdc20-cdc27 4 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_box deletion of aas 86-90 - DRFIP binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role prey prey physical association physical association Fig 2F. the kimata reference uses this version of the cdc protein- as it gives 507 aas - the other protein (Q8AVG7) has 508. TAME does not inhibit the interaction between the C-box and the APC. cdh1-cdc27-1 1 21 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait c terminus IR tail binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n terminus Mts-Atf-Biotin tag biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2G, S2B, S2C. Blasting the stated sequence of the Cdh1 C-terminal peptide shows it does not correspond to the C terminal sequence for Xenopus Laevis Cdh1, however, it does correspond to the C terminus of Chicken Cdh1 and the C terminus of Xenopus Fizzy-related protein (fzr1). TAME Four proteins known to exist in an APC subcomplex, namely, Cdc27, Cdc16, Cdc23, and Apc7, were crosslinked in an IR-dependent manner that could be competed by excess unlabeled IR peptide. i have left this as a biotin tag (rather than just "tag") - and added the rest of the label in the full name - as the biotin part is used in detection. n_cdc20-cdc27-1 2 23 unspecified role unspecified role prey prey ir_tail C terminal IR tail binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait physical association physical association Fig 3. TAME, C box containing N-terminal fragment of Cdc20 (aa's 1-159). should the cdc20 aas 1-159 be added as an separate interactor/compeditor? In the presence of the C-box-containing N-terminal fragment of Cdc20, the addition of TAME or deletion of the IR-tail was sufficient to completely suppress Cdc20 association with cdc27. cdc27-cadh1 10 20 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig 4C. pro-TAME; a cell permeable derivative of TAME. cdh1-cdc27-2 9 21 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig S1E. there is no gene(ncbi or ensembl or xenbase) xenla entry for apc1- no publications in xenbase. The participant EBI-2944289(C6ZIW0) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. cdc27-cdc20 7 15 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig S5D, S5E, S6B. proTAME induced significant dissociation of Cdc20/cdc27, but only if SAC proteins were depleted by RNAi (Fig S5D). Hesperadin treatment led to dissociation of Mad2 and BubR1 from the APC in proTAME-arrested cells (Fig S5E). Hesperadin reduces the amount of Mad2/BubR1 bound to the cdc27 in cells arrested in mitosis with MG132 (Fig S6B). Hesperadin - a small molecule inhibitor of chromosome alignment and segregation.