I2D I2D Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down autoradiography autoradiography Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that all Plk1 constructs are of human origin eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa lysates were fractionated by FPLC on Superose 6 column eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Phosphorylation by polo-like kinase 1 induces the tumor-suppressing activity of FADD. Oncogene (0950-9232) 2011 imex curation Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer eunhee@cnu.ac.kr 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Jang MS., Lee SJ., Kim CJ., Lee CW., Kim E. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms that all Plk1 constructs are of human origin eunhee@cnu.ac.kr Accepted 2011-MAY-11 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database plk1_human Serine/threonine-protein kinase PLK1 Polo-like kinase 1 Serine/threonine-protein kinase 13 PLK1 PLK protein protein human Homo sapiens Human MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS DIP protein P53350 original sequence version: 169 DIP protein P53350 original sequence version: 170 DIP protein P53350 original sequence version: 164 DIP protein P53350 original sequence version: 154 DIP protein P53350 original sequence version: 91 DIP protein P53350 original sequence version: 145 DIP protein P53350 original sequence version: 121 DIP protein P53350 original sequence version: 118 DIP protein P53350 original sequence version: 123 DIP protein P53350 original sequence version: 119 DIP protein P53350 original sequence version: 138 DIP protein P53350 original sequence version: 163 DIP protein P53350 original sequence version: 178 178C2F13C10E8206 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 fadd-plk1 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association The interaction of Plk1 and FADD increases with increased concentration of Taxol (0.025-30uM) and duration of stimulation by 25uM Taxol (0-24hr). 1a,b fadd-plk1-2 5 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association 1c Endogenous Plk1 and FADD cofiltrate as a low-molecular-weight complex (43kDa). After stimulation with 25nM Taxol, Plk1 and FADD cofiltrate as a high-molecular-weight complex (>200kDa) plk1-fadd 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 1d fadd-plk1-9 6 7 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53350:p.Thr210Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:40:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr210ala' Tue Jun 30 16:45:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr210Ala' human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 2b Interaction detected after treatment with 25nM taxol for 12 hr. Flag-Plk1 was immunoprecipitated from HeLa cells using anti-Flag antibody. The immunoprecipitates were then incubated with GST-FADD in the presence of [32P]ATP. Proteins were then visualized using autoradiography. fadd-plk1-3 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association 2c fadd-plk1-7 6 7 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53350:p.Thr210Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:33:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr210ala' Tue Jun 30 19:28:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr210Ala' ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13158:p.Ser194Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:33:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser194ala' Tue Jun 30 15:51:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser194Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 2d GST-C-FADD or GST-C-FADD S194A was incubated with GST-Plk1 in the presence of [32P]ATP fadd-plk1-4 2 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization S1 Taxol treatment of cells resulted in colocalization fadd-plk1-5 2 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component phospho group opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain colocalization colocalization S1 Taxol treatment of cells resulted in colocalization fadd-plk1-8 6 7 enzyme enzyme unspecified role unspecified role 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation S3