I2D I2D Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-ht1080 Homo sapiens HT1080 fribrosarcoma cell line ht1080 confirmed as human with IEF of AST, LDH, NP established from the biopsy from a fibrosarcoma of a 35-year-old Caucasian man in 1972 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mfhistiocytoma Human malignant fibrous histiocytoma mfhistiocytoma Malignant fibrous histiocytoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Rejected 2011-JUN-21 by MGT. same as for Expt 9. You have not made an entry for Figure S3C - Interaction Detection method =BIFC looks to be the most appropriate .[...between two non fluorescent fragments of the yellow fluorescent protein (YFP)] ( Child of Complementation Assay) - The split tag used is "Venus", an eYFP variant - not "Venous" as stated under fig S3... dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database For Fig 5c,e an HA tag is mentioned on page 19 and 21 of the supp exp data...do you still want me to remove it? Also I didn't enter the DD mutation because it doesn't change the ability of the AKT1 to phosphorylate GST-VIM and since the two experiments (AKT1+GST-VIM and AKT1DD+GST-VIM are not side by side I didn't feel confident about calling it a mutation decreasing). Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Rejected 2011-JUN-20 by MGT. I have altered the short label of this Expt (and also Expt 2) to zhu-2011a-1/2 from zhu-2011b-1/2 - how they became re-named I would not like to imagine...I have not reported a bug as it is possible you altered them yourself, but if you are sure you did not, I would report it - I did mention it to Bruno... This Expt is basically OK apart from the fact I cannot see where you found the amino acid numbers for the HEAD/TAIL regions of Vim/AKT1 - I cannot find them in the paper or Supplement. If the authors provided them there should be a Data Processing comment to this effect, if taken from UniProt (AKT1 tail region not given) they should be entered in the form 2..2-95..95. Amino acid numbering for regions of Vimentin/AKT1 taken from primers listed in the materials and methods. dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis The molecule "alpha-Actin, identifier Gi73947744" has not been entered, as the nearest match is (human) O43707 (Alpha-actinin-4) , which shares 96% identity with GI:73947744, which is a canine protein. Author confirms that SKLMS-1 cells were used. dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mfh_m Human high grade malignant fibrosarcoma primary cell line mfh_m Human high grade malignant fibrosarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-uncl Human unclassified pleomorphic sarcoma primary cell line uncl Human unclassified pleomorphic sarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-leiomyosarcoma Human leiomyosarcoma leiomyosarcoma Leiomyosarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Vimentin is a novel AKT1 target mediating motility and invasion. Vimentin is a novel AKT1 target mediating motility and invasion. Oncogene (0950-9232) 2011 imex curation Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer dlev@mdanderson.org 21-Dec-2011: Contacted by JYOTI. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-leio_177 Human high grade leiomyosarcoma primary cell line leio_177 Human high grade leiomyosarcoma primary cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu QS., Rosenblatt K., Huang KL., Lahat G., Brobey R., Bolshakov S., Nguyen T., Ding Z., Belousov R., Bill K., Luo X., Lazar A., Dicker A., Mills GB., Hung MC., Lev D. Apoptosis - Interactions involving proteins with a function related to apoptosis dlev@mdanderson.org Accepted 2011-SEP-26 by MGT 21-Dec-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database tpm4_human Tropomyosin alpha-4 chain TPM4 Tropomyosin-4 TM30p1 protein protein human Homo sapiens Human MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI 5D5CDF6BF76552A8 tbb4b_human Tubulin beta-4B chain TUBB4B TUBB2C Tubulin beta-2 chain Tubulin beta-2C chain protein protein human Homo sapiens Human MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA A552C52822AFA072 trhde_human Thyrotropin-releasing hormone-degrading ectoenzyme Pyroglutamyl-peptidase II TRH-specific aminopeptidase Thyroliberinase UNQ2507/PRO5995 TRHDE protein protein human Homo sapiens Human MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH B82FBBC93927F6DC gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 crosstide Crosstide Ser/Thr protein kinase substrate peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GRPRTSSFAEG tpm2_human Tropomyosin beta chain TPM2 TMSB Tropomyosin-2 Beta-tropomyosin protein protein human Homo sapiens Human MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL 18E330568E14E0BE actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP DIP protein Q00987 original sequence version: 93 DIP protein Q00987-1 original sequence version: 192 DIP protein Q00987 original sequence version: 88 DIP protein Q00987 original sequence version: 180 DIP protein Q00987 original sequence version: 188 DIP protein Q00987 original sequence version: 189 DIP protein Q00987 original sequence version: 115 DIP protein Q00987-1 original sequence version: null DIP protein Q00987 original sequence version: 149 DIP protein Q00987 original sequence version: 146 DIP protein Q00987 original sequence version: 140 DIP protein Q00987 original sequence version: 183 DIP protein Q00987 original sequence version: 145 DIP protein Q00987 original sequence version: 182 DIP protein Q00987 original sequence version: 151 DIP protein Q00987 original sequence version: 156 DIP protein Q00987-1 original sequence version: 160 DIP protein Q00987 original sequence version: 160 DIP protein Q00987 original sequence version: 168 DIP protein Q00987 original sequence version: 186 DIP protein Q00987 original sequence version: 206 F37CE163876BC983 ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ DIP protein P17844 original sequence version: 98 DIP protein P17844 original sequence version: 148 DIP protein P17844 original sequence version: 137 DIP protein P17844 original sequence version: 124 DIP protein P17844 original sequence version: 177 DIP protein P17844-1 original sequence version: 177 DIP protein P17844 original sequence version: 179 DIP protein P17844 original sequence version: 182 84DF684FD6871594 akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA DIP protein P31749 original sequence version: 184 DIP protein P31749 original sequence version: 168 DIP protein P31749 original sequence version: 102 DIP protein P31749 original sequence version: 110 DIP protein P31749 original sequence version: 160 DIP protein P31749 original sequence version: 136 DIP protein P31749 original sequence version: 175 DIP protein P31749 original sequence version: 201 DIP protein P31749 original sequence version: 166 DIP protein P31749 original sequence version: 178 DIP protein P31749-1 original sequence version: 194 DIP protein P31749 original sequence version: 106 DIP protein P31749 original sequence version: 141 6EAFF4F8AD436714 akt2_human RAC-beta serine/threonine-protein kinase AKT2 RAC-PK-beta Protein kinase Akt-2 Protein kinase B beta protein protein human Homo sapiens Human MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE DIP protein P31751 original sequence version: 137 DIP protein P31751 original sequence version: 155 B18C87A7246BFB24 vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ DIP protein P38646 original sequence version: 188 90969A8D06757753 akt1-vim 1 28 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association 3c vim-akt1 1 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c vim-akt1-1 6 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-1 6 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-3 11 30 unspecified role unspecified role prey prey human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. 28 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 4b vim-akt1-2 11 30 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 28 unspecified role unspecified role prey prey human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. physical association physical association 4c akt1-vim-4 11 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4d vim-akt1-3 11 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4d akt1-ddx5-3 12 24 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey association association 3a, Table S1 akt1-ddx5-2 6 27 unspecified role unspecified role prey prey 30 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association 3a Author confirms that SKLMS-1 cells were used for this experiment. akt1-gsk3b 6 26 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association 3a Author confirms that SKLMS-1 cells were used for this experiment. vim-akt1-4 17 30 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey physical association physical association 3c akt1-vim-5 17 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-6 2 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association 3c vim-akt1-5 2 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c akt2-vim 2 29 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association 3c vim-akt2 2 30 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association 3c vim-akt2-1 17 30 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association 3c akt2-vim-1 17 29 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association 3c vim-akt1-6 7 28 unspecified role unspecified role prey prey P31749:p.[Lys179Ala;Thr308Ala;Ser473Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:58:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys179ala,thr308ala,ser473ala' Tue Jun 30 19:12:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys179Ala;Thr308Ala;Ser473Ala]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P31749:p.[Thr308Asp;Ser473Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain T D Fri Jul 22 11:13:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser473asp,thr308asp' Wed May 02 16:29:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr308asp,ser473asp' Tue Jun 30 18:23:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr308Asp;Ser473Asp]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 30 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P08670:p.Ser39Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:23:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser39ala' Tue Jun 30 19:11:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser39Ala' P08670:p.Ser325Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:20:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser325ala' Tue Jun 30 18:24:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser325Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 5c, e Phosphorylation of vimentin. akt1-vim-7 5 28 unspecified role unspecified role neutral component neutral component 30 unspecified role unspecified role neutral component neutral component colocalization colocalization S3a akt1-vim-8 10 28 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization S3b akt1-vim-9 16 28 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role prey prey physical association physical association S3d vim-akt1-7 4 30 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S3d akt1-vim-11 8 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association S3e vim-akt1-8 8 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association S3e akt1-vim-15 9 28 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) colocalization colocalization S3f akt1-vim-12 13 28 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association 3c vim-akt1-10 13 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-13 14 28 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association 3c vim-akt1-11 14 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c vim-akt1-12 18 28 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-14 18 30 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association 3c akt1-crosstide 15 28 unspecified role unspecified role bait bait human-sklms1 Human vulva leiomyosarcoma sklms1 Human vulval leiomyosarcoma ATCC accession number: HTB-88 This cell line has a codon 245 p53 point mutation. 23 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation 2c Crosstide is phosphorylated by AKT1. EGF akt1-crosstide-1 15 28 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 23 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation 2c Crosstide is phosphorylated by AKT1. EGF akt2-crosstide 15 23 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 29 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma phosphorylation phosphorylation reaction phosphorylation 2c Crosstide is phosphorylated by AKT2. EGF akt2-vim-2 14 30 unspecified role unspecified role prey prey 29 unspecified role unspecified role bait bait physical association physical association 3c vim-akt2-2 14 29 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait physical association physical association 3c akt1-vim-16 3 28 unspecified role unspecified role neutral component neutral component venus_n_terminal_region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role neutral component neutral component venus_c_terminal_region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S3c