IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. Cell. Signal. (0898-6568) 2011 imex curation Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw Accepted 2011-OCT-04 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell. Signal. (0898-6568) 2011 Only protein-protein interactions imex curation The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. Cell. Signal. (0898-6568) 2011 imex curation Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw Accepted 2011-OCT-04 by ORCHARD Cell. Signal. (0898-6568) 2011 Only protein-protein interactions imex curation The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. Cell. Signal. (0898-6568) 2011 imex curation Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw Accepted 2011-OCT-04 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell. Signal. (0898-6568) 2011 Only protein-protein interactions imex curation The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. The MYND domain-containing protein BRAM1 inhibits lymphotoxin beta receptor-mediated signaling through affecting receptor oligomerization. Cell. Signal. (0898-6568) 2011 imex curation Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu H.P., Chung P.J., Liang C.L., Chang Y.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of TRAF2 (EBI-4372617) given by author via e-mail. Interactions involving MTG8 were not included because the origin of the protein was not stated by the author. hpliu08@mail.cgu.edu.tw, pjc@mail.cgu.edu.tw, longer@csmu.edu.tw, ysc@mail.cgu.edu.tw Accepted 2011-OCT-04 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell. Signal. (0898-6568) 2011 Only protein-protein interactions imex curation tnr3_human Tumor necrosis factor receptor superfamily member 3 LTBR D12S370 TNFCR TNFR3 TNFRSF3 Lymphotoxin-beta receptor Tumor necrosis factor C receptor Tumor necrosis factor receptor 2-related protein Tumor necrosis factor receptor type III protein protein human Homo sapiens Human MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD 624626E6022F656F traf3_human TNF receptor-associated factor 3 TRAF3 CAP1 CRAF1 CD40 receptor-associated factor 1 CD40-binding protein LMP1-associated protein 1 CAP-1 RING-type E3 ubiquitin transferase TRAF3 protein protein human Homo sapiens Human MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP DIP protein Q13114 original sequence version: 158 DIP protein Q13114 original sequence version: 127 DIP protein Q13114 original sequence version: 146 DIP protein Q13114 original sequence version: 151 9456E440C0A90FBF traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 deaf1_human Deformed epidermal autoregulatory factor 1 homolog Nuclear DEAF-1-related transcriptional regulator Suppressin Zinc finger MYND domain-containing protein 5 DEAF1 SPN ZMYND5 protein protein human Homo sapiens Human MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVANAASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPYKRRKKENELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFDRASTVEATAVISESPAQGDVFAGATVQEASVQPPCRASHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVLTSLPALAVPPPTPTKAAPPALVNGLELSEPRSWLYLEEMVNSLLNTAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVTV 3BDFEDBF6AD4BDDE zmy11_human Zinc finger MYND domain-containing protein 11 BRAM1 Bone morphogenetic protein receptor-associated molecule 1 ZMYND11 Adenovirus 5 E1A-binding protein BS69 Protein BS69 protein protein human Homo sapiens Human MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR 3AD525B90574BDE8 ltbr-zmynd11-1 2 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait cytoplasmic tail experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 ltbr-ltbr 2 5 unspecified role unspecified role bait bait cytoplasmic tail experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey cytoplasmic tail experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain 18 16 physical association physical association Table 1 ltbr-zmynd11-2 2 9 unspecified role unspecified role prey prey c-terminal region experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait cytoplasmic tail experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain self-association+traf domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain c-terminal tail sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1a ltbr-zmynd11-3 3 9 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1b ltbr-deaf1 3 8 unspecified role unspecified role prey prey c-terminal region experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1b ltbr-zmynd11-4 1 9 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 and 3b ltbr-ltbr-1 1 5 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2 Coexpression with ha-zmynd11 (BRAM1) disrupts the interaction in a dose-dependent manner. ltbr-zmynd11-5 1 9 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3a ltbr-traf2 1 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3a Coexpression with ha-zmynd11 (BRAM1) disrupts the interaction in a dose-dependent manner. ltbr-traf3 4 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3b Coexpression with ha-zmynd11 (BRAM!) disrupts the interaction in a dose-dependent manner.