InnateDB InnateDB Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Nat. Immunol. (1529-2908) 2010 imex curation Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis 293 cells were also transfected with untagged Syk expression plasmids Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org Accepted 2011-MAR-22 by ORCHARD Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Nat. Immunol. (1529-2908) 2010 imex curation Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-macrophage Mus musculus macrophage macrophage Macrophage fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret immunostaining immunostaining Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org Accepted 2011-MAR-22 by ORCHARD Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Integrin CD11b negatively regulates TLR-triggered inflammatory responses by activating Syk and promoting degradation of MyD88 and TRIF via Cbl-b. Nat. Immunol. (1529-2908) 2010 imex curation Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han C., Jin J., Xu S., Liu H., Li N., Cao X. Apoptosis - Interactions involving proteins with a function related to apoptosis Peritoneal macrophages were collected from Itgam-/- mice caoxt@immunol.org Accepted 2011-MAR-22 by ORCHARD Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity tcam1_mouse TIR domain-containing adapter molecule 1 Ticam1 Trif Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta protein protein mouse Mus musculus Mouse MDNPGPSLRGAFGILGALERDRLTHLKHKLGSLCSGSQESKLLHAMVLLALGQDTEARVSLESLKMNTVAQLVAHQWADMETTEGPEEPPDLSWTVARLYHLLAEENLCPASTRDMAYQVALRDFASQGDHQLGQLQNEAWDRCSSDIKGDPSGFQPLHSHQGSLQPPSASPAVTRSQPRPIDTPDWSWGHTLHSTNSTASLASHLEISQSPTLAFLSSHHGTHGPSKLCNTPLDTQEPQLVPEGCQEPEEISWPPSVETSVSLGLPHEISVPEVSPEEASPILPDALAAPDTSVHCPIECTELSTNSRSPLTSTTESVGKQWPITSQRSPQVPVGDDSLQNTTSSSPPAQPPSLQASPKLPPSPLSSASSPSSYPAPPTSTSPVLDHSETSDQKFYNFVVIHARADEQVALRIREKLETLGVPDGATFCEEFQVPGRGELHCLQDAIDHSGFTILLLTASFDCSLSLHQINHALMNSLTQSGRQDCVIPLLPLECSQAQLSPDTTRLLHSIVWLDEHSPIFARKVANTFKTQKLQAQRVRWKKAQEARTLKEQSIQLEAERQNVAAISAAYTAYVHSYRAWQAEMNKLGVAFGKNLSLGTPTPSWPGCPQPIPSHPQGGTPVFPYSPQPPSFPQPPCFPQPPSFPQPPSFPLPPVSSPQSQSFPSASSPAPQTPGPQPLIIHHAQMVQLGVNNHMWGHTGAQSSDDKTECSENPCMGPLTDQGEPLLETPE DIP protein Q80UF7 original sequence version: 82 DIP protein Q80UF7 original sequence version: 83 DIP protein Q80UF7 original sequence version: 81 2EAC87F1936B7C83 cblb_mouse E3 ubiquitin-protein ligase CBL-B Cblb Casitas B-lineage lymphoma proto-oncogene b SH3-binding protein CBL-B Signal transduction protein CBL-B RING-type E3 ubiquitin transferase CBL-B protein protein mouse Mus musculus Mouse MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSIIDPFSIPMLDLDDDDDREESLMMNRLASVRKCTDRQNSPVTSPGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPERPPPIPPDNRLSRHFHHGESVPSRDQPMPLEAWCPRDAFGTNQVMGCRILGDGSPKPGVTANSSLNGRHSRMGSEQVLMRKHRRHDLPSEGAKVFSNGHLATEEYDVPPRLSPPPPVTTLLPSIKCTGPLANCLSEKTRDTVEDDDDEYKIPSSHPVSLNSQPSHCHNVKAPVRSCDNGHCILNGTHGAPSEMKKSNIPDLGIYLKGGGSDSASDPVPLPPARPPPRDSPKHGSSVNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPGSSSRPSSGQDLFLLPSDPFFDPTSGQVPLPPARRAAGDSGKANRASQDYDQLPSSSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL 14B55C4106F84A86 ksyk_mouse Tyrosine-protein kinase SYK Syk Spleen tyrosine kinase Sykb ptk72 protein protein mouse Mus musculus Mouse MAGSAVDSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQMGHPGSPNAHPVTWSPGGIISRIKSYSFPKPGHKKPAPPQGSRPESTVSFNPYEPTGGPWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLDRSLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFTAVELRLRNYYYDVVN DIP protein P48025 original sequence version: 108 DIP protein P48025 original sequence version: 125 2F98D21601F8224E itb2_mouse Integrin beta-2 Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta Complement receptor C3 subunit beta Itgb2 protein protein mouse Mus musculus Mouse MLGLRPSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES DIP protein P11835 original sequence version: 95 6FA51DA93AB40D8A myd88_mouse Myeloid differentiation primary response protein MyD88 Myd88 protein protein mouse Mus musculus Mouse MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP DIP protein P22366 original sequence version: 131 DIP protein P22366 original sequence version: 141 DIP protein P22366-1 original sequence version: 143 DIP protein P22366-1 original sequence version: 144 DIP protein P22366 original sequence version: 122 393A75C3723FFE69 itam_mouse Integrin alpha-M Itgam CD11 antigen-like family member B CR-3 alpha chain Cell surface glycoprotein MAC-1 subunit alpha Leukocyte adhesion receptor MO1 protein protein mouse Mus musculus Mouse MTLKALLVTALALCHGFNLDTEHPMTFQENAKGFGQNVVQLGGTSVVVAAPQEAKAVNQTGALYQCDYSTSRCHPIPLQVPPEAVNMSLGLSLAVSTVPQQLLACGPTVHQNCKENTYVNGLCYLFGSNLLRPPQQFPEALRECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSASITSNGPLLGSVGSFDWAGGAFLYTSKDKVTFINTTRVDSDMNDAYLGYASAVILRNRVQSLVLGAPRYQHIGLVVMFRENFGTWEPHTSIKGSQIGSYFGASLCSVDMDADGNTNLILIGAPHYYEKTRGGQVSVCPLPRGRARWQCEALLHGDQGHPWGRFGAALTVLGDVNGDKLTDVAIGAPGEQENQGAVYIFYGASIASLSASHSHRIIGAHFSPGLQYFGQSLSGGKDLTMDGLMDLAVGAQGHLLLLRAQPVLRLEATMEFSPKKVARSVFACQEQVLKNKDAGEVRVCLRVRKNTKDRLREGDIQSTVTYDLALDPVRSRIRAFFDETKNNTRRRTQVFGLMQKCETLKLILPDCVDDSVSPIILRLNYTLVGEPLRSFGNLRPVLAMDAQRFFTAMFPFEKNCGNDSICQDDLSITMSAMGLDTLVVGGPQDFNMSVTLRNDGEDSYGTQVTVYYPSGLSYRKDSASQNPLTKKPWFVKPAESSSSSEGHGALKSTTWNINHPIFPANSEVTFNVTFDVDSHASFGNKLLLKAIVASENNMSRTHKTKFQLELPVKYAIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFNNLGQRSLPVSVVFWIPVQINNVTVWDHPQVIFSQNLSSACHTEQKSPPHSNFRDQLERTPVLNCSVAVCKRIQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHGHLLLVSSTEILFNDSAFALLPGQESYVRSKTETKVEPYEVHNPVPLIVGSSIGGLVLLALITAGLYKLGFFKRQYKDMMNEAAPQDAPPQ 178DB988AECB0343 itam-itgb2 2 9 unspecified role unspecified role fret pair fluorescence acceptor donor pair fret pair region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind range range range range 7 unspecified role unspecified role fret pair fluorescence acceptor donor pair fret pair region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind range range range range proximity proximity close-contact colocalization neighbourhood interaction LPS for 0, 5, 15mins LPS for 0, 5, 15mins FRET efficiency decrease as LPS stimulation time increased Exact details of constructs not given in the text so have been inferred from the UniProtKB entries. syk-myd88-1 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Fig. 5A LPS for 0, 15, 45, 90 and 240mins. Interaction peaked at 15-240min time points. interaction is stronger in Itgam+/- in comparison to Itgam-/- murine macrophages cblb-myd88-2 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig. 6A LPS for 0, 45, 90 and 240mins. Interaction peaked at 90-240min time points. interaction is stronger in Itgam+/- in comparison to Itgam-/- murine macrophages cblb-myd88-1 1 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P22366:p.Tyr227Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 17:03:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr227phe' Tue Jun 30 18:56:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr227Phe' physical association physical association Fig. 6D cblb-tcam1 1 4 unspecified role unspecified role prey prey Q80UF7:p.Tyr375Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:07:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr375phe' Tue Jun 30 15:50:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr375Phe' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E