UniProt UniProt http://www.uniprot.org Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Mol. Cell. Biol. (0270-7306) 2010 mimix curation Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER fig 4 EMSA assay DNA-NFkappaB complex not annotated Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com 23-Sept-2011: Contacted by JYOTI. orchard human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER tarik.moroy@ircm.qc.ca Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com Accepted 2011-JUL-20 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2010 orchard mimix curation Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Mol. Cell. Biol. (0270-7306) 2010 mimix curation Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER fig 4 EMSA assay DNA-NFkappaB complex not annotated Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com 23-Sept-2011: Contacted by JYOTI. orchard human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER tarik.moroy@ircm.qc.ca Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com Accepted 2011-JUL-20 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2010 orchard mimix curation Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Mol. Cell. Biol. (0270-7306) 2010 mimix curation Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER fig 4 EMSA assay DNA-NFkappaB complex not annotated Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com 23-Sept-2011: Contacted by JYOTI. orchard mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER tarik.moroy@ircm.qc.ca Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com Accepted 2011-JUL-20 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2010 orchard mimix curation Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Mol. Cell. Biol. (0270-7306) 2010 mimix curation Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER fig 4 EMSA assay DNA-NFkappaB complex not annotated Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com 23-Sept-2011: Contacted by JYOTI. orchard mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER tarik.moroy@ircm.qc.ca Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com Accepted 2011-JUL-20 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2010 orchard mimix curation Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Zinc finger protein Gfi1 controls the endotoxin-mediated Toll-like receptor inflammatory response by antagonizing NF-kappaB p65. Mol. Cell. Biol. (0270-7306) 2010 mimix curation Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER fig 4 EMSA assay DNA-NFkappaB complex not annotated Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com 23-Sept-2011: Contacted by JYOTI. orchard mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Sharif-Askari E., Vassen L., Kosan C., Khandanpour C., Gaudreau M.C., Heyd F., Okayama T., Jin J., Rojas M.E., Grimes H.L., Zeng H., Moroy T. Apoptosis - Interactions involving proteins with a function related to apoptosis for transfected proteins mouse origin was assumed. already contacted the moroy group for another paper and they have used mouse Gfi1 there. BER tarik.moroy@ircm.qc.ca Tarik.Moroy@ircm.qc.ca,zenghui@mail.bjdth.com Accepted 2011-JUL-20 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2010 orchard mimix curation tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 nfkb1_human Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI DIP protein P19838 original sequence version: 202 DIP protein P19838 original sequence version: 192 DIP protein P19838 original sequence version: 195 2A7C8FF86A10D1A8 tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK DIP protein Q99684 original sequence version: 93 DIP protein Q99684 original sequence version: 94 740A466F72C5FC72 gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK 63AB726025300B6B gfi1-rela 1 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5d gfi1-rela-1 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 5b nfkb1-rela-1 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 5b For NFKB1 (Ac P19838 ) Nuclear factor NF-kappa-B p50 subunit (PRO_0000030311) is indicated as participant rela-nfkb1-13 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 5b For NFKB1 (Ac P19838 ) Nuclear factor NF-kappa-B p50 subunit (PRO_0000030311) is indicated as participant gfi1-rela-2 5 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 7 gfi1-rela-3 3 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 6c and e gfi1-rela-4 4 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 5