IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. J. Biol. Chem. (0021-9258) 2010 Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no jyoti in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no Accepted 2011-APR-19 by JYOTI J. Biol. Chem. (0021-9258) 2010 jyoti p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. J. Biol. Chem. (0021-9258) 2010 Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no jyoti human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no Accepted 2011-APR-19 by JYOTI J. Biol. Chem. (0021-9258) 2010 jyoti p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. J. Biol. Chem. (0021-9258) 2010 Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no jyoti human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no Accepted 2011-APR-19 by JYOTI J. Biol. Chem. (0021-9258) 2010 jyoti p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. p62/SQSTM1 is a target gene for transcription factor NRF2 and creates a positive feedback loop by inducing antioxidant response element-driven gene transcription. J. Biol. Chem. (0021-9258) 2010 Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no jyoti mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Jain A., Lamark T., Sjottem E., Larsen KB., Awuh JA., Overvatn A., McMahon M., Hayes JD., Johansen T. Apoptosis - Interactions involving proteins with a function related to apoptosis terje.johansen@uit.no Accepted 2011-APR-19 by JYOTI J. Biol. Chem. (0021-9258) 2010 jyoti sqstm_human_gene Sequestosome-1gene gene gene human Homo sapiens Human nf2l2_human Nuclear factor erythroid 2-related factor 2 NFE2L2 NRF2 Nuclear factor, erythroid derived 2, like 2 HEBP1 protein protein human Homo sapiens Human MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN DIP protein Q16236 original sequence version: 80 DIP protein Q16236 original sequence version: 103 DIP protein Q16236 original sequence version: 148 DIP protein Q16236 original sequence version: 102 DIP protein Q16236-1 original sequence version: 113 99FAFD811B6C1416 sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL DIP protein Q13501 original sequence version: 139 DIP protein Q13501 original sequence version: 142 DIP protein Q13501 original sequence version: 163 DIP protein Q13501 original sequence version: 146 DIP protein Q13501 original sequence version: 162 DIP protein Q13501 original sequence version: 155 DIP protein Q13501 original sequence version: 140 462D94C171F337CD keap1_human Kelch-like ECH-associated protein 1 Cytosolic inhibitor of Nrf2 Kelch-like protein 19 KEAP1 INRF2 KIAA0132 KLHL19 protein protein human Homo sapiens Human MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC DIP protein Q14145 original sequence version: 107 DIP protein Q14145 original sequence version: 138 DIP protein Q14145 original sequence version: 153 DIP protein Q14145 original sequence version: 106 DIP protein Q14145 original sequence version: 163 CE180F3897BB8C97 gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 keap1-sqstm-1 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14145:p.Tyr525Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:46:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr525ala' Tue Jun 30 16:15:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr525Ala' Q14145:p.Tyr572Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:02:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr572ala' Tue Jun 30 19:29:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr572Ala' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3B, 3F keap1-sqstm-2 3 8 unspecified role unspecified role prey prey mcherry tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14145:p.Tyr572Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:10:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr572ala' Tue Jun 30 17:31:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr572Ala' 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3H nfe2l2-sqstm 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association Fig. 1D NFE2L2 binds to the promoter region of SQSTM1. PCR analyses of the immunoprecipitated chromatin were carried out using primers flanking the ARE (position −1324 and −1173, respectively). sqstm1-keap1-1 1 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 3B, 3F gabarap-sqstm1-3 1 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain certain certain sequence position certain range range region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 competitor competitor competitor ancillary ancillary in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5B Exact coordinates of SQSTM1 PB1 domain not given so have been inferred from the UniProtKB entry. gabarap-sqstm1-4 1 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range range range certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5B Exact coordinates of SQSTM1 PB1 domain not given so have been inferred from the UniProtKB entry. keap1-sqstm1 4 7 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component mcherry tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 7C