MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. EMBO J. (0261-4189) 2010 imex curation Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr Accepted 2012-FEB-01 by MGT EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. EMBO J. (0261-4189) 2010 imex curation Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. EMBO J. (0261-4189) 2010 imex curation Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. EMBO J. (0261-4189) 2010 imex curation Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr Accepted 2012-FEB-01 by MGT 14-Mar-2012: Contacted by JYOTI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 ppia_mouse Peptidyl-prolyl cis-trans isomerase A Ppia Cyclophilin A Cyclosporin A-binding protein SP18 Rotamase A protein protein mouse Mus musculus Mouse MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 3528824224EA8849 h2ax_mouse Histone H2AX H2ax H2a.x H2afx Hist5-2ax Histone H2A.X protein protein mouse Mus musculus Mouse MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY A3683760C13CC2B9 aifm1_mouse Apoptosis-inducing factor 1, mitochondrial Programmed cell death protein 8 Aifm1 Aif Pdcd8 protein protein mouse Mus musculus Mouse MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED A17EDFD5CF77BB85 q9z0x1-pro_0000022031 Apoptosis-inducing factor 1, mitochondrial Aifm1 Aif Pdcd8 Programmed cell death protein 8 protein protein mouse Mus musculus Mouse GLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED 102 612 98FEAA29F0330E2A aifm1-h2afx-1 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1b Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. aifm1-h2afx-7 2 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 1d Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. aifm1-h2afx-3 3 5 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2a Dissociation of the tAIF/H2AX complex shows two phases, one slow and one fast. aifm1-h2afx-5 3 5 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 8 competitor competitor competitor neutral component neutral component purified purified proline-rich binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9Z0X1:p.[Pro543Ala;Pro544Ala;Pro547Ala;Pro550Ala;Pro553Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:14:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro543ala,pro544ala,pro547ala,pro550ala,pro553ala' Tue Jun 30 16:32:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro543Ala;Pro544Ala;Pro547Ala;Pro550Ala;Pro553Ala]' ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2b In this experiment, binding affinities of different forms of AIF were monitored by their ability to inhibit the binding of soluble H2AX to inmobilized tAIF. h2afx-aifm1-1 4 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1c and S8 left Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. ppia-aifm1 4 6 unspecified role unspecified role bait bait purified purified 8 unspecified role unspecified role prey prey physical association physical association S8 right Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. The presence of H2AX is also required, as shown by the absence of interaction in H2AX -/- nuclei.