UniProt UniProt http://www.uniprot.org SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT 21-Dec-2011: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT 21-Dec-2011: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT 21-Dec-2011: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT 21-Dec-2011: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation SIRT1 deacetylates APE1 and regulates cellular base excision repair. SIRT1 deacetylates APE1 and regulates cellular base excision repair. Nucleic Acids Res. (0305-1048) 2010 imex curation Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay western blot western blot Immuno blot Immuno blot Yamamori T., DeRicco J., Naqvi A., Hoffman T.A., Mattagajasingh I., Kasuno K., Jung S.B., Kim C.S., Irani K. Apoptosis - Interactions involving proteins with a function related to apoptosis potential candidate for imex level Origin and details of SIRT1 in deacetylase assay (fig 2a) according to supplier. iranik@upmc.edu Accepted 2011-OCT-19 by MGT 21-Dec-2011: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 Only protein-protein interactions imex curation sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F apex1_human DNA-(apurinic or apyrimidinic site) endonuclease Apurinic-apyrimidinic endonuclease 1 APEX nuclease APE1 APEX1 APE APEX APX HAP1 REF1 REF-1 Redox factor-1 protein protein human Homo sapiens Human MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL DIP protein P27695 original sequence version: 139 DIP protein P27695 original sequence version: 152 DIP protein P27695 original sequence version: 187 B88579C01BAF80C6 xrcc1_human DNA repair protein XRCC1 XRCC1 X-ray repair cross-complementing protein 1 protein protein human Homo sapiens Human MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGGSGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA DIP protein P18887 original sequence version: 120 DIP protein P18887 original sequence version: 161 30DB3321234DBFC2 apex1-sirt1 2 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q96EB6:p.His363Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 18:36:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his363tyr' Tue Jun 30 19:55:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His363Tyr' 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B sirt1-apex1 2 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A apex1-sirt1-1 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1C apex1-sirt1-2 1 8 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 1D APE1 and SIRT1 co-localized to the extra-nucleolar region of nuclei of HEK 293 cells. sirt1-apex1-1 5 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1E H2O2 treatment apex1-sirt1-3 6 8 enzyme target enzyme target substrate substrate neutral component neutral component region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A xrcc1-apex1 4 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P27695:p.Lys6_Lys7delinsArgArg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain KK RR Thu Jul 07 12:06:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys6arg_lys7arg Fri Jul 22 10:58:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys6arg,lys7arg' Wed May 02 19:28:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_lys6-7arg_arg' Tue Jun 30 19:36:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys6_Lys7delinsArgArg' physical association physical association 6A, B, C, D, E Promoted by SIRT1 (AC Q96EB6). Stimulated by genotoxic stress (methyl methanesulfonate/MMS treatment)