DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Fig 5D(E) cannot be annotated as there is no other interactor apart from axin-1- (PAR is not a molecule, but a region - "Using an antibody that specifically recognizes the PAR modification") LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. competition binding competition binding western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis The addition of increasing amounts of LDW643 does not block binding. No details for methods given. LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. TNKS has not been entered as the authors state that both TNKS1 and TNKS2 were used. The authors confirm that 293 cells were used. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study tag fluorescence tag visualisation by fluorescence tag fluorescence Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The proteins used have been confirmed as being Human in origin, by the authors. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The recombinant proteins used have been confirmed to be human by the authors. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study ms participant Identification by mass spectrometry ms participant Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis The paper calls these "Biochemical Assays" (of unspecified type....). -these must also be "In Vitro parsylation assays"- see Expt details given in Supplement at end of the section on "In vitro PARsylation", as in "LC/MS-based high throughput auto-PARsylation assays for PARP1, PARP2, TNKS1, and TNKS2". (I removed biotin tags from NAD). LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. The proteins used have been confirmed as being Human ibn origin, by the authors. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Nature (0028-0836) 2009 imex curation Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling. Nature (0028-0836) 2009 imex curation Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. competition binding competition binding sequence tag sequence tag identification sequence tag Huang S.M., Mishina Y.M., Liu S., Cheung A., Stegmeier F., Michaud G.A., Charlat O., Wiellette E., Zhang Y., Wiessner S., Hild M., Shi X., Wilson C.J., Mickanin C., Myer V., Fazal A., Tomlinson R., Serluca F., Shao W., Cheng H., Shultz M., Rau C., Schirle M., Schlegl J., Ghidelli S., Fawell S., Lu C., Curtis D., Kirschner M.W., Lengauer C., Finan P.M., Tallarico J.A., Bouwmeester T., Porter J.A., Bauer A., Cong F. Apoptosis - Interactions involving proteins with a function related to apoptosis LDW639 (a bioactive analogue of XAV939, coupled to Sepharose beads) was used to affinity capture cellular proteins from HEK293 cell lysates pre incubated with an excess amount of XAV939, or the inactive analogue LDW643, or DMSO. Bound material was differentially iTRAQ labelled and LS-MS/MS carried out. Specific binding of proteins to LDW639 was competed with by soluble XAV939, but not the inactive LDW643. Results shown here are the 18 proteins with >3 spectrum matches to unique peptides. feng.cong@novartis.com Accepted 2011-OCT-12 by ORCHARD Nature (0028-0836) 2009 imex curation baf_human Barrier-to-autointegration factor BANF1 BAF BCRG1 Breakpoint cluster region protein 1 protein protein human Homo sapiens Human MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL DIP protein O75531 original sequence version: 123 9A2180A2D284F5D0 parp2_human Poly [ADP-ribose] polymerase 2 PARP2 ADPRT2 ADPRTL2 NAD(+) ADP-ribosyltransferase 2 Poly[ADP-ribose] synthase 2 ADP-ribosyltransferase diphtheria toxin-like 2 DNA ADP-ribosyltransferase PARP2 Protein poly-ADP-ribosyltransferase PARP2 protein protein human Homo sapiens Human MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDGMPGRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYATNTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW DIP protein Q9UGN5 original sequence version: 99 5B7AE8AE531836AF gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 veliparib/abt-888 ABT-888 -VELIPARIB small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tnks2_human Poly [ADP-ribose] polymerase tankyrase-2 TNKS2 PARP5B TANK2 TNKL Poly [ADP-ribose] polymerase 5B TNKS-2 TRF1-interacting ankyrin-related ADP-ribose polymerase 2 Tankyrase II Tankyrase-like protein Tankyrase-related protein ADP-ribosyltransferase diphtheria toxin-like 6 Protein poly-ADP-ribosyltransferase tankyrase-2 Tankyrase-2 protein protein human Homo sapiens Human MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASSLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG DIP protein Q9H2K2 original sequence version: 154 DIP protein Q9H2K2 original sequence version: 107 4C8B3B8D97CEF704 h2aj_human Histone H2A.J H2AJ H2AFJ protein protein human Homo sapiens Human MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK E35049617B456D45 nad+ nicotinamide adenine dinucleotide - oxidised form small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD DIP protein P35244 original sequence version: 96 3FD99851959FB498 iwr-1-exo IWR-1-exo small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) xav939 XAV939 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) chebi details to be added when available Chemical Name: 3,5,7,8-Tetrahydro-2-[4-(trifluorom ethyl)phenyl]-4H-thiopyrano[4,3-d]pyrimidin-4-one chebi details to be added when available Chemical Name: 3,5,7,8-Tetrahydro-2-[4-(trifluorom ethyl)phenyl]-4H-thiopyrano[4,3-d]pyrimidin-4-one parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI DIP protein P13010 original sequence version: 128 DIP protein P13010 original sequence version: 127 DIP protein P13010 original sequence version: 122 DIP protein P13010 original sequence version: 174 DIP protein P13010 original sequence version: 153 DIP protein P13010 original sequence version: 155 DIP protein P13010 original sequence version: 142 2363CA84834E74A3 axin1_mouse Axin-1 Axin1 Axin Fu Axis inhibition protein 1 Protein Fused protein protein mouse Mus musculus Mouse MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRVQSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTSAPSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 2216D66E92387B81 axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD DIP protein O15169 original sequence version: 118 DIP protein O15169 original sequence version: 125 DIP protein O15169-1 original sequence version: 140 DIP protein O15169 original sequence version: 132 10779173F5092F3F rfa1_human Replication protein A 70 kDa DNA-binding subunit Replication factor A protein 1 Single-stranded DNA-binding protein RPA1 REPA1 RPA70 protein protein human Homo sapiens Human MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM DIP protein P27694 original sequence version: 116 DIP protein P27694 original sequence version: 146 DIP protein P27694 original sequence version: 111 DIP protein P27694 original sequence version: 125 FE038F40F5886CD1 sp16h_human FACT complex subunit SPT16 Facilitates chromatin transcription complex subunit SPT16 FACT 140 kDa subunit FACTp140 Chromatin-specific transcription elongation factor 140 kDa subunit SUPT16H FACT140 FACTP140 protein protein human Homo sapiens Human MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK DIP protein Q9Y5B9 original sequence version: 74 DIP protein Q9Y5B9 original sequence version: 110 3E1B23C45BDC61C2 tnks1_human Poly [ADP-ribose] polymerase tankyrase-1 TNKS PARP5A PARPL TIN1 TINF1 TNKS1 Tankyrase I TNKS-1 TRF1-interacting ankyrin-related ADP-ribose polymerase Poly [ADP-ribose] polymerase 5A ADP-ribosyltransferase diphtheria toxin-like 5 Protein poly-ADP-ribosyltransferase tankyrase-1 Tankyrase-1 protein protein human Homo sapiens Human MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT DIP protein O95271 original sequence version: 148 DIP protein O95271 original sequence version: 149 DIP protein O95271-1 original sequence version: 113 44BDE985C715BEFF gmds_human GDP-mannose 4,6 dehydratase GDP-D-mannose dehydratase GMDS protein protein human Homo sapiens Human MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA B1BAC441736D4C2B h32_human Histone H3.2 H3C13 H3C14 H3C15 H3-clustered histone 13 H3-clustered histone 14 H3-clustered histone 15 H3F2 H3FM HIST2H3A HIST2H3C HIST2H3D Histone H3/m Histone H3/o protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein Q71DI3 original sequence version: 82 DIP protein Q71DI3 original sequence version: 133 DIP protein Q71DI3 original sequence version: 140 DIP protein Q71DI3 original sequence version: 107 6FD8508EA50A0EEC iwr-1-endo IWR-1-endo small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) emd_human Emerin EDMD STA EMD protein protein human Homo sapiens Human MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF DIP protein P50402 original sequence version: 95 DIP protein P50402 original sequence version: 125 EB62EDD59B7A044F znrd2_human Protein ZNRD2 ZNRD2 Autoantigen p27 SSSCA1 Sjoegren syndrome/scleroderma autoantigen 1 Zinc ribbon domain-containing protein 2 protein protein human Homo sapiens Human MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPAPAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH EF08439FDFFA1DAB xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB ssrp1_human FACT complex subunit SSRP1 SSRP1 FACT80 Facilitates chromatin transcription complex subunit SSRP1 Facilitates chromatin transcription complex 80 kDa subunit Chromatin-specific transcription elongation factor 80 kDa subunit Structure-specific recognition protein 1 Recombination signal sequence recognition protein 1 T160 protein protein human Homo sapiens Human MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE DIP protein Q08945 original sequence version: 121 DIP protein Q08945 original sequence version: 144 4E7EE3735EB41082 rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 axin2_human Axin-2 AXIN2 Axin-like protein Axis inhibition protein 2 Conductin protein protein human Homo sapiens Human MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID DIP protein Q9Y2T1 original sequence version: 142 DIP protein Q9Y2T1 original sequence version: 110 F7B62BED6AB4664D ldw639-xav939-14 9 20 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-12 9 20 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-13 9 18 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-3 9 26 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-2 9 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-15 9 20 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-4 9 20 competitor competitor competitor bait bait 17 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-16 9 20 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-5 9 20 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-6 9 22 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-7 9 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-8 9 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-17 9 33 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-9 9 35 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-18 9 25 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-10 9 27 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2A ldw639-xav939-11 9 20 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey physical association physical association Fig 2A ldw639-xav939-19 9 20 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association Fig 2A papr1-xav939 3 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2B parp2-xav939-20 3 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig 2B tnks-xav939 7 27 unspecified role unspecified role neutral component neutral component parp_domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 2c tnks2-xav939 7 20 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined parp_domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain direct interaction direct interaction Fig 2c parp1-xav939-1 7 20 unspecified role unspecified role neutral component neutral component region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 2c nad_tnks2 5 16 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 inhibitor inhibitor neutral component neutral component 14 putative self putative self putative self putative self sam+parp_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined adp ribosylation adp ribosylation reaction adp ribosylation Fig 3H, 5C. Auto-poly ADP ribosylation of TNKS2 nad-tnks2 8 14 putative self putative self putative self putative self 20 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 abt_888-nad_ 8 16 electron acceptor electron acceptor neutral component neutral component 27 putative self putative self putative self putative self 13 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 nad_-parp2 8 11 putative self putative self putative self putative self 20 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of PARP2 nad_-parp1 8 16 electron acceptor electron acceptor neutral component neutral component 21 putative self putative self putative self putative self 20 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of PARP1 abt_888-tnks2 8 13 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component 14 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 nad_-tnks-2 8 27 putative self putative self putative self putative self 20 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 abt_888-nad_-1 8 16 electron acceptor electron acceptor neutral component neutral component 21 putative self putative self putative self putative self 13 inhibitor inhibitor unspecified role unspecified role adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of PARP1 abt_888-nad_-2 8 13 inhibitor inhibitor unspecified role unspecified role 16 electron acceptor electron acceptor neutral component neutral component 11 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of PARP2 iwr_1_endo-nad_ 8 30 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component 27 putative self putative self putative self putative self adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 iwr_1_endo-nad_-1 8 30 inhibitor inhibitor neutral component neutral component 14 putative self putative self putative self putative self 16 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 iwr_1_exo-nad_ 8 19 inhibitor inhibitor neutral component neutral component 14 putative self putative self putative self putative self 16 electron acceptor electron acceptor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS2 iwr_1_exo-nad_-1 8 16 electron acceptor electron acceptor neutral component neutral component 27 putative self putative self putative self putative self 19 inhibitor inhibitor neutral component neutral component adp ribosylation adp ribosylation reaction adp ribosylation Fig 3I. Auto-poly-ADP-ribosylation of TNKS1 axin2-tnks 1 14 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 36 unspecified role unspecified role bait bait association association Fig 4A axin1-tnks-3 6 27 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 4B axin1-tnks-1 4 27 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 23 unspecified role unspecified role bait bait tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 4D tnks-axin1-1 2 23 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tbd_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 27 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4D axin1-gsk3b-2 1 24 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association S1B XAV939 axin1-nad_-2 5 20 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 16 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 14 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 23 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) adp ribosylation adp ribosylation reaction adp ribosylation Fig 5C Poly ADP ribosylation of Axin-1. nad_-tnks2 5 14 putative self putative self putative self putative self n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 20 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) adp ribosylation adp ribosylation reaction adp ribosylation Fig S3i Auto-poly ADP ribosylation of TNKS2. IWR-1-endo and XAV939 inhibit the auto-poly ADP ribosylation of TNKS2. iwr_1_endo-nad_-3 5 30 inhibitor inhibitor neutral component neutral component 16 electron acceptor electron acceptor neutral component neutral component region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 14 putative self putative self putative self putative self n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range adp ribosylation adp ribosylation reaction adp ribosylation Fig S3i Auto-poly-adp ribosylation of TNKS2. IWR-1-endo and XAV939 inhibit the auto-poly ADP ribosylation of TNKS2. axin1-tnks-2 6 23 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey ankyrin_rpt_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supplementary Fig. 6a.