UniProt UniProt http://www.uniprot.org Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pull down pull down anti tag western anti tag western blot anti tag western Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. Transcriptional corepressor SMILE recruits SIRT1 to inhibit nuclear receptor estrogen receptor-related receptor gamma transactivation. J. Biol. Chem. (0021-9258) 2009 mimix curation Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr 14-Mar-2012: Contacted by JYOTI. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Xie Y.B., Park J.H., Kim D.K., Hwang J.H., Oh S., Park S.B., Shong M., Lee I.K., Choi H.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of used plasmids (SMILE, SIRT1 and ERRgamma) confirmed by authors (e-mail). hsc@chonnam.ac.kr Accepted 2011-DEC-01 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2009 mimix curation err3_human Estrogen-related receptor gamma ESRRG ERR3 ERRG2 KIAA0832 NR3B3 ERR gamma-2 Estrogen receptor-related protein 3 Nuclear receptor subfamily 3 group B member 3 protein protein human Homo sapiens Human MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV 63D36CFD37573152 zhang_mouse CREB/ATF bZIP transcription factor Crebzf Zf Host cell factor-binding transcription factor Zhangfei Tyrosine kinase-associated leucine zipper protein LAZip protein protein mouse Mus musculus Mouse MRHSLTKLLAASGRDFPSRRDSREPPATRAPPREPSGAAAGAETPRPGSPDREQPHGDGDGGEPEARSGSRGSVAVRAPAPSPLKMEEEEEDAIAMVPKEEPEDMDFLSGLELADLLDPRQPDWHLEPGLSSPGPLSSSGGGSESGGLLRGDDDDDTAAAEMQRFSDLLQRLLNGIGGCSSGGDRGGGEKRRRKSPGAGGGGANDGNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQPPEPREEDDAAGGVCLHVDKDKVSVEFCSACARKASSSLKM F7CC810EC242C24D sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F err3_mouse Estrogen-related receptor gamma Esrrg Err3 Kiaa0832 Nr3b3 Estrogen receptor-related protein 3 Nuclear receptor subfamily 3 group B member 3 protein protein mouse Mus musculus Mouse MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV 63D36CFD37573152 zhang_human CREB/ATF bZIP transcription factor Host cell factor-binding transcription factor Zhangfei CREBZF ZF protein protein human Homo sapiens Human MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM DIP protein Q9NS37 original sequence version: 104 BE3AC77203216155 crebzf-esrrg 2 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1C crebzf-esrrg-1 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1C crebzf-esrrg-2 6 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1C crebzf-esrrg-3 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1A and 3B crebzf-esrrg-4 7 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 1D crebzf-esrrg-5 3 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 3D, 6C crebzf-sirt1 5 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 5E crebzf-sirt1-1 3 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 5F crebzf-sirt1-2 2 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 5G crebzf-crebzf 3 12 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association S3B crebzf-esrrg-6 1 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 1C