IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. Proteomics 2009 imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com Accepted 2010-APR-9 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. proteomics 2009 orchard Only protein-protein interactions imex curation LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. Proteomics 2009 imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com Accepted 2010-APR-9 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. proteomics 2009 orchard Only protein-protein interactions imex curation LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. Proteomics 2009 imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com Accepted 2010-APR-9 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. proteomics 2009 orchard Only protein-protein interactions imex curation LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes. Proteomics 2009 imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com Accepted 2010-APR-9 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. proteomics 2009 orchard Only protein-protein interactions imex curation ndus1_human NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial NDUFS1 Complex I-75kD protein protein human Homo sapiens Human MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC 9C35F4B8294771FB nduba_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 NDUFB10 NADH-ubiquinone oxidoreductase PDSW subunit Complex I-PDSW protein protein human Homo sapiens Human MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS DIP protein O96000 original sequence version: 123 A5E6561402F4486A ndus2_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial NDUFS2 NADH-ubiquinone oxidoreductase 49 kDa subunit Complex I-49kD protein protein human Homo sapiens Human MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAHWKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR A2BF56F008B6312C qcr8_human Cytochrome b-c1 complex subunit 8 Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Complex III subunit VIII Complex III subunit 8 UQCRQ protein protein human Homo sapiens Human MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK 5ED13ABDD2990DD2 atp5l_human ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein human Homo sapiens Human MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 03D484BCF836E6C2 cox2_human Cytochrome c oxidase subunit 2 MT-CO2 COII COXII MTCO2 Cytochrome c oxidase polypeptide II COX2 protein protein human Homo sapiens Human MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL DIP protein P00403 original sequence version: null 402A3145241DDEE6 ndub3_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 NADH-ubiquinone oxidoreductase B12 subunit Complex I-B12 NDUFB3 protein protein human Homo sapiens Human MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH 1C77F0C7A4DC757F ndua8_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 NDUFA8 NADH-ubiquinone oxidoreductase 19 kDa subunit Complex I-19kD Complex I-PGIV protein protein human Homo sapiens Human MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK E1647472B69E1149 ndua6_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 LYRM6 NADH-ubiquinone oxidoreductase B14 subunit Complex I-B14 LYR motif-containing protein 6 NDUFA6 NADHB14 protein protein human Homo sapiens Human MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP DIP protein P56556 original sequence version: null 5EE10C571A659D8B ndus7_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial NADH-ubiquinone oxidoreductase 20 kDa subunit Complex I-20kD PSST subunit NDUFS7 protein protein human Homo sapiens Human MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR B3547EA24643C1B0 cx7a2_human Cytochrome c oxidase subunit 7A2, mitochondrial COX7AL Cytochrome c oxidase subunit VIIa-liver/heart COX7A2 protein protein human Homo sapiens Human MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE 490F45059CAF971F nduc2_human NADH dehydrogenase [ubiquinone] 1 subunit C2 NDUFC2 HLC1 NADH-ubiquinone oxidoreductase subunit B14.5b Complex I-B14.5b Human lung cancer oncogene 1 protein protein protein human Homo sapiens Human MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR 9A47DEE33DC9244D at5f1_human ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase proton-transporting mitochondrial F(0) complex subunit B1 ATP synthase subunit b ATP5F1 protein protein human Homo sapiens Human MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM 743B1C54BFFEBBBD nu4m_human NADH-ubiquinone oxidoreductase chain 4 MT-ND4 MTND4 NADH4 ND4 NADH dehydrogenase subunit 4 protein protein human Homo sapiens Human MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS 2EEE581F3BD270AF nduad_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 NDUFA13 CGI-39 CDA016 NADH-ubiquinone oxidoreductase B16.6 subunit Complex I-B16.6 Gene associated with retinoic and interferon-induced mortality 19 protein Cell death regulatory protein GRIM-19 GRIM19 protein protein human Homo sapiens Human MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT DIP protein Q9P0J0 original sequence version: null DIP protein Q9P0J0 original sequence version: 100 058F608B235FF856 sdha_human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial SDHA SDH2 SDHF Flavoprotein subunit of complex II protein protein human Homo sapiens Human MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY DIP protein P31040 original sequence version: 196 DIP protein P31040 original sequence version: 181 180B664E3FFD0B34 atp5j_human ATP synthase-coupling factor 6, mitochondrial ATP5PF ATP synthase peripheral stalk subunit F6 ATP5A ATP5J ATPM protein protein human Homo sapiens Human MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA EDC1A14F01A10F17 atpb_human ATP synthase subunit beta, mitochondrial ATP5F1B ATP synthase F1 subunit beta ATP5B ATPMB ATPSB protein protein human Homo sapiens Human MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS 960C616A2252B91A ndua4_human Cytochrome c oxidase subunit NDUFA4 NADH-ubiquinone oxidoreductase MLRQ subunit Complex I-MLRQ NDUFA4 protein protein human Homo sapiens Human MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF 2FA1D1115EDE24C7 nduv1_human NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial NADH-ubiquinone oxidoreductase 51 kDa subunit Complex I-51kD NADH dehydrogenase flavoprotein 1 NDUFV1 UQOR1 protein protein human Homo sapiens Human MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS 8C261EA3B0267256 atp5s_human ATP synthase subunit s, mitochondrial DMAC2L ATP synthase-coupling factor B ATP5S ATPW Distal membrane arm assembly complex 2-like protein Mitochondrial ATP synthase regulatory component factor B protein protein human Homo sapiens Human MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK DFDCDE6D81E5DC62 ndubb_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial NDUFB11 UNQ111/PRO1064 NADH-ubiquinone oxidoreductase ESSS subunit Complex I-ESSS Neuronal protein 17.3 protein protein human Homo sapiens Human MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE 2AF8FDD248A86C41 ndub5_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial NDUFB5 NADH-ubiquinone oxidoreductase SGDH subunit Complex I-SGDH protein protein human Homo sapiens Human MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN 66D288F7AB7FD5C5 ndua9_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial NADH-ubiquinone oxidoreductase 39 kDa subunit Complex I-39kD NDUFA9 NDUFS2L protein protein human Homo sapiens Human MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI DIP protein Q16795 original sequence version: 88 66A1CC7FCE86DD0E atpk_human ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 ATP5JL protein protein human Homo sapiens Human MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH D5F0D94273DEF880 cox41_human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial COX4I1 COX4 Cytochrome c oxidase subunit IV isoform 1 Cytochrome c oxidase polypeptide IV protein protein human Homo sapiens Human MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK F6382FFDCF3BE4ED qcr2_human Cytochrome b-c1 complex subunit 2, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 2 Core protein II Complex III subunit 2 UQCRC2 protein protein human Homo sapiens Human MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL BFA655C24C07AF52 ndus4_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial NDUFS4 NADH-ubiquinone oxidoreductase 18 kDa subunit Complex I-18 kDa Complex I-AQDQ protein protein human Homo sapiens Human MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK DE5B51DBDD76231E ndus5_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 NDUFS5 NADH-ubiquinone oxidoreductase 15 kDa subunit Complex I-15 kDa protein protein human Homo sapiens Human MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP 3D55402837DD99EE cox7c_human Cytochrome c oxidase subunit 7C, mitochondrial Cytochrome c oxidase polypeptide VIIc COX7C protein protein human Homo sapiens Human MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT A7DF0F4BAF39FB28 atpg_human ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 ATP5CL1 F-ATPase gamma subunit protein protein human Homo sapiens Human MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD 021A95168FD53E04 nduf3_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 NDUFAF3 C3orf60 protein protein human Homo sapiens Human MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ FCFF7B0CB6ADBCD8 nu1m_human NADH-ubiquinone oxidoreductase chain 1 MT-ND1 MTND1 NADH1 ND1 NADH dehydrogenase subunit 1 protein protein human Homo sapiens Human MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT 2F771ACB95002591 ucri_human Cytochrome b-c1 complex subunit Rieske, mitochondrial Ubiquinol-cytochrome c reductase iron-sulfur subunit Rieske iron-sulfur protein Complex III subunit 5 Rieske protein UQCRFS1 UQCRFS1 Cytochrome b-c1 complex subunit 5 protein protein human Homo sapiens Human MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 8DB51634DEB039B0 cox5b_human Cytochrome c oxidase subunit 5B, mitochondrial Cytochrome c oxidase polypeptide Vb COX5B protein protein human Homo sapiens Human MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH 877BF4CD334AC931 ndus8_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial NDUFS8 NADH-ubiquinone oxidoreductase 23 kDa subunit Complex I-23kD TYKY subunit protein protein human Homo sapiens Human MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 8C3EBD205BFA0112 qcr1_human Cytochrome b-c1 complex subunit 1, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 1 Complex III subunit 1 UQCRC1 Core protein I protein protein human Homo sapiens Human MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF E76B082166CAF48F cox5a_human Cytochrome c oxidase subunit 5A, mitochondrial Cytochrome c oxidase polypeptide Va COX5A protein protein human Homo sapiens Human MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 104DAF468BD302FC qcr7_human Cytochrome b-c1 complex subunit 7 Ubiquinol-cytochrome c reductase complex 14 kDa protein Complex III subunit 7 Complex III subunit VII QP-C UQCRB UQBP protein protein human Homo sapiens Human MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK E61629D06DFA55B7 nduab_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 NDUFA11 NADH-ubiquinone oxidoreductase subunit B14.7 Complex I-B14.7 protein protein human Homo sapiens Human MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV 379D58482D7E8BDB nduaa_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial NDUFA10 NADH-ubiquinone oxidoreductase 42 kDa subunit Complex I-42kD protein protein human Homo sapiens Human MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK B5C27BC150A3E691 ndub8_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial NADH-ubiquinone oxidoreductase ASHI subunit Complex I-ASHI NDUFB8 protein protein human Homo sapiens Human MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI 518459D44965D202 nduf4_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 NDUFAF4 C6orf66 HRPAP20 Hormone-regulated proliferation-associated protein of 20 kDa HSPC125 My013 protein protein human Homo sapiens Human MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYVDSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK B6445B0B4AA905D0 atp5i_human ATP synthase subunit e, mitochondrial ATP5ME ATP5I ATP synthase membrane subunit e ATP5K protein protein human Homo sapiens Human MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK E4FF2B855F4535DC nduv2_human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial NADH-ubiquinone oxidoreductase 24 kDa subunit NDUFV2 protein protein human Homo sapiens Human MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL AAF46ABB0908B177 nduv3_human NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial Complex I-9kD Renal carcinoma antigen NY-REN-4 NADH-ubiquinone oxidoreductase 9 kDa subunit NDUFV3 protein protein human Homo sapiens Human MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH BD7375474AB0B1EC ndus6_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial NADH-ubiquinone oxidoreductase 13 kDa-A subunit Complex I-13kD-A NDUFS6 protein protein human Homo sapiens Human MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH 0A1465160BCA772D qcr9_human Cytochrome b-c1 complex subunit 9 UQCR10 HSPC119 UCRC Ubiquinol-cytochrome c reductase complex 7.2 kDa protein Cytochrome c1 non-heme 7 kDa protein Complex III subunit X Complex III subunit 9 protein protein human Homo sapiens Human MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK 12CCBC666F54E464 nduac_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 NDUFA12 DAP13 NADH-ubiquinone oxidoreductase subunit B17.2 Complex I-B17.2 13 kDa differentiation-associated protein protein protein human Homo sapiens Human MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK C76C7F2F5974AFF9 ndus3_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial NDUFS3 NADH-ubiquinone oxidoreductase 30 kDa subunit Complex I-30kD protein protein human Homo sapiens Human MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK C058D62779BEF17B C058D62779BEF17B cox6c_human Cytochrome c oxidase subunit 6C COX6C Cytochrome c oxidase polypeptide VIc protein protein human Homo sapiens Human MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK D09FEE0C0AA7A798 cx6b1_human Cytochrome c oxidase subunit 6B1 COX6B1 COX6B Cytochrome c oxidase subunit VIb isoform 1 protein protein human Homo sapiens Human MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI 15C8B056491FB248 ndua7_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 NADH-ubiquinone oxidoreductase subunit B14.5a Complex I-B14.5a NDUFA7 protein protein human Homo sapiens Human MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL 0B6BF051809B5E9E atp5h_human ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H My032 protein protein human Homo sapiens Human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL E93020ADA1BA1694 ndua2_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 NDUFA2 NADH-ubiquinone oxidoreductase B8 subunit Complex I-B8 protein protein human Homo sapiens Human MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA EF026F193CAF1DF7 atpa_human ATP synthase subunit alpha, mitochondrial ATP5F1A ATP synthase F1 subunit alpha ATP5A ATP5A1 ATP5AL2 ATPM protein protein human Homo sapiens Human MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA DIP protein P25705 original sequence version: null DIP protein P25705 original sequence version: 136 AA47BBB8EDA77EAC ndub7_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 NDUFB7 NADH-ubiquinone oxidoreductase B18 subunit Complex I-B18 Cell adhesion protein SQM1 protein protein human Homo sapiens Human MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL 2743716544288776 ndub9_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 LYRM3 NADH-ubiquinone oxidoreductase B22 subunit Complex I-B22 LYR motif-containing protein 3 NDUFB9 UQOR22 protein protein human Homo sapiens Human MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM 2287AE8757F85E68 ndua5_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 Complex I subunit B13 NADH-ubiquinone oxidoreductase 13 kDa-B subunit Complex I-13kD-B NDUFA5 protein protein human Homo sapiens Human MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI 652339C1127E6F22 sdhb_human Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial SDHB SDH SDH1 Iron-sulfur subunit of complex II protein protein human Homo sapiens Human MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV DIP protein P21912 original sequence version: 198 ED12E7C3BA7B6D13 atpd_human ATP synthase subunit delta, mitochondrial ATP5F1D ATP synthase F1 subunit delta ATP5D F-ATPase delta subunit protein protein human Homo sapiens Human MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE B7F0D1D01ADFDFE7 ndufa2-ndufa4-1 3 23 unspecified role unspecified role neutral component neutral component 27 unspecified role unspecified role neutral component neutral component 37 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 61 unspecified role unspecified role neutral component neutral component 45 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 49 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 40 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 62 unspecified role unspecified role neutral component neutral component 51 unspecified role unspecified role neutral component neutral component 32 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 44 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 57 unspecified role unspecified role neutral component neutral component 53 unspecified role unspecified role neutral component neutral component 28 unspecified role unspecified role neutral component neutral component 50 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 33 unspecified role unspecified role neutral component neutral component 46 unspecified role unspecified role neutral component neutral component 59 unspecified role unspecified role neutral component neutral component 54 unspecified role unspecified role neutral component neutral component 63 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B, Table 1 and supporting information Fig. 3 The authors identified 32 out of the 45 OXPHOS complexe I subunits The GI numbers 17981862, 21361822 and 38524585 do not match any UniProtKB IDs. The appropriate UniProtKB IDs are respectively P03905, Q9P0J0 and O75251 which match 278, 9 and 7 different GI numbers. Pearson's correlations between each of these subunits were used to empirically determine a cut-off value of r=0.7, above which profiles retrieved by PCP were considered for further analysis. A protein identified by PCP was considered as a candidate when it had a Pearson's correlation factor of r=0.7 in each BN gel for the template pattern (p<0.0001) and if it had a reported mitochondrial localization or predicted to be mitochondrial by at least two out of five mitochondrial prediction algorithms sdha-sdhb-6 3 64 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 2 out of the 4 OXPHOS complexe II subunits The GI number 4759080 does not match any UniProtKB ID. The appropriate UniProtKB ID is P31040 and matches 11 different GI numbers. Pearson's correlations between each of these subunits were used to empirically determine a cut-off value of r=0.7, above which profiles retrieved by PCP were considered for further analysis. A protein identified by PCP was considered as a candidate when it had a Pearson's correlation factor of r=0.7 in each BN gel for the template pattern (p<0.0001) and if it had a reported mitochondrial localization or predicted to be mitochondrial by at least two out of five mitochondrial prediction algorithms uqcr10-5 3 52 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 43 unspecified role unspecified role neutral component neutral component 41 unspecified role unspecified role neutral component neutral component 38 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 6 out of the 11 OXPHOS complexe III subunits The GI number 5174743 doesn't match any uniprot ID. \n The appropriate uniprot ID is P47985 and matches 9 different GI numbers. cox4i1-8 3 10 unspecified role unspecified role neutral component neutral component 39 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 55 unspecified role unspecified role neutral component neutral component 30 unspecified role unspecified role neutral component neutral component 42 unspecified role unspecified role neutral component neutral component 56 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 8 out of the 13 OXPHOS complexe IV subunits The GI numbers 4758038 does not match any UniProtKB ID. The appropriate UniProtKB ID is P20674 and matches 9 different GI numbers. atp5a1-10 3 60 unspecified role unspecified role neutral component neutral component 35 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component 58 unspecified role unspecified role neutral component neutral component 65 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 22 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 48 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 11 out of the 17 OXPHOS complexe V subunits mt_nd1-31 4 57 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 28 unspecified role unspecified role neutral component neutral component 44 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 63 unspecified role unspecified role neutral component neutral component 33 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 49 unspecified role unspecified role neutral component neutral component 40 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 45 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 37 unspecified role unspecified role neutral component neutral component 59 unspecified role unspecified role neutral component neutral component 51 unspecified role unspecified role neutral component neutral component 54 unspecified role unspecified role neutral component neutral component 50 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 53 unspecified role unspecified role neutral component neutral component 32 unspecified role unspecified role neutral component neutral component 27 unspecified role unspecified role neutral component neutral component 61 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 62 unspecified role unspecified role neutral component neutral component 46 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B, Table 1 and supporting information Fig. 3 The authors identified 32 out of the 45 OXPHOS complexe I subunits The GI numbers 17981862, 21361822 and 38524585 do not match any UniProtKB IDs. The appropriate UniProtKB IDs are respectively P03905, Q9P0J0 and O75251 and match respectively 278, 9 and 7 different GI numbers. sdha-sdhb 4 20 unspecified role unspecified role neutral component neutral component 64 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 2 out of the 4 OXPHOS complexe II subunits The GI number 4759080 does not match any UniProtKB ID. The appropriate UniProtKB ID is P31040 and matches 11 different GI numbers. uqcr10-6 4 43 unspecified role unspecified role neutral component neutral component 41 unspecified role unspecified role neutral component neutral component 31 unspecified role unspecified role neutral component neutral component 38 unspecified role unspecified role neutral component neutral component 52 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 6 out of the 11 OXPHOS complexe III subunits The GI number 5174743 doesn't match any UniProtKB ID. The appropriate UniProtKB ID is P47985 and matches 9 different GI numbers. cox4i1-7 4 10 unspecified role unspecified role neutral component neutral component 34 unspecified role unspecified role neutral component neutral component 42 unspecified role unspecified role neutral component neutral component 39 unspecified role unspecified role neutral component neutral component 56 unspecified role unspecified role neutral component neutral component 30 unspecified role unspecified role neutral component neutral component 55 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 8 out of the 13 OXPHOS complexe IV subunits The GI numbers 4758038 does not match any UniProtKB ID. The appropriate UniProtKB ID is P20674 and matches 9 different GI numbers. atp5a1-10 4 60 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 65 unspecified role unspecified role neutral component neutral component 48 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 35 unspecified role unspecified role neutral component neutral component 58 unspecified role unspecified role neutral component neutral component 22 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component physical association physical association Supplementary table 1, Fig. 2 A and B The authors identified 11 out of the 17 OXPHOS complexe V subunits ndufs2-ndufs3 1 7 unspecified role unspecified role neutral component neutral component 54 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3. B To correlate our data with previously described intermediates [26] we aligned NDUFS2, NDUFS3 and COXII patterns with 2-D BN SDS-PAGE Western blot immunodetections The subunits NDFUS2 and NDUFS3 seem to be found in 6 different complexes. (the mitochondrial respiratory chain complex I and 5 different holocomplexes or assembly intermediates) primary antibodies against NDUFS2 and NDUFS3 for the immunoblot ndufs2-ndufs3 2 54 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3. B To correlate our data with previously described intermediates [26] we aligned NDUFS2, NDUFS3 and COXII patterns with 2-D BN SDS-PAGE Western blot immunodetections The subunits NDFUS2 and NDUFS3 seem to be found in 6 different complexes. (the mitochondrial respiratory chain complex I and 5 different holocomplexes or assembly intermediates) primary antibodies against NDUFS2 and NDUFS3 for the immunoblot ndufaf3-3 1 36 unspecified role unspecified role neutral component neutral component 47 unspecified role unspecified role neutral component neutral component 54 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 4. A, B and C C3ORF60 accurately comigrates with C6ORF66 and with four out of the six complex I assembly intermediates containing NDUFS2 and NDUFS3 The subunits NDFUS2 and NDUFS3 and the proteins C3orf60 and C3orf66 seem to be found in 4 different complexes. primary antibodies against NDUFS2, NDUFS3, C3orf60 and C3orf66 for the immunoblot ndufaf3-3 2 36 unspecified role unspecified role neutral component neutral component 54 unspecified role unspecified role neutral component neutral component 47 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 4. A, B and C C3ORF60 accurately comigrates with C6ORF66 and with four out of the six complex I assembly intermediates containing NDUFS2 and NDUFS3 The subunits NDFUS2 and NDUFS3 and the proteins C3orf60 and C3orf66 seem to be found in 4 different complexes. primary antibodies against NDUFS2, NDUFS3, C3orf60 and C3orf66 for the immunoblot