IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 rat-spinal-cord Rattus norvegicus spinal cord spinal-cord spinal cord anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 rat-spinal-cord Rattus norvegicus spinal cord spinal-cord spinal cord anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation A class of dynamin-like GTPases involved in the generation of the tubular ER network. A class of dynamin-like GTPases involved in the generation of the tubular ER network. Cell (0092-8674) 2009 imex curation Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 23 rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Hu J., Shibata Y., Zhu PP., Voss C., Rismanchi N., Prinz WA., Rapoport TA., Blackstone C. Apoptosis - Interactions involving proteins with a function related to apoptosis Enzyme activity measured by the generation of free phosphate. tom_rapoport@hms.harvard.edu Accepted 2009-NOV-7 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 23 imex curation atla1_rat Atlastin-1 Atl1 Spg3a Spastic paraplegia 3A homolog protein protein rat Rattus norvegicus (Rat) Rat MAKSRRDRNSWGGFSEKSSDWSSEEEEPVRKAGPVQVLIVKDDHSFELDEAALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEDSVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYQQAFPAPKSEPTEQPEKKKI 4FFDE569007E171F q9jk11-3 Reticulon-4 Nogo-C VP20 Rtn4 Nogo Foocen Glut4 vesicle 20 kDa protein Neurite outgrowth inhibitor protein protein rat Rattus norvegicus (Rat) Rat MDGQKKHWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAD 2FD805453543DC95 atla1_human Atlastin-1 ATL1 GBP3 SPG3A Spastic paraplegia 3 protein A Guanine nucleotide-binding protein 3 GTP-binding protein 3 Brain-specific GTP-binding protein protein protein human Homo sapiens Human MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM DIP protein Q8WXF7 original sequence version: 118 DIP protein Q8WXF7 original sequence version: 95 68A33C39DD43504C atla2_human Atlastin-2 ATL2 ARL6IP2 ADP-ribosylation factor-like protein 6-interacting protein 2 protein protein human Homo sapiens Human MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD 885738C43996DEBF sey1_yeast Protein SEY1 SEY1 YOR165W Synthetic enhancer of YOP1 protein O3590 protein protein yeast Saccharomyces cerevisiae Baker's yeast MADRPAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNTNFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFERKAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIRDHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQDVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVARFKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYMEKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEKEFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHVIHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAWRTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVFEVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQFRRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFVIHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK DEC0C9EC3AB172DF DEC0C9EC3AB172DF q9es97-3 Reticulon-3 Rtn3c Rtn3 B1 A1 protein protein mouse Mus musculus Mouse MAESSAATQSPSVSSSSSGAEPSALGGGGGSPGACPALGAKSCGSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE EB60A0A7AC45F0DE rtn1_yeast Reticulon-like protein 1 RTN1 YDR233C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVEISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADVPLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA 245575E65D3C2193 245575E65D3C2193 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 reep5_mouse Receptor expression-enhancing protein 5 Reep5 Dp1 Polyposis locus protein 1 homolog Protein TB2 homolog GP106 protein protein mouse Mus musculus Mouse MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLRHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGDVKKST 706F03AB257D7D0C q9jk11-1 Reticulon-4 Nogo-A NI-220-250 Rtn4 Nogo Foocen Glut4 vesicle 20 kDa protein Neurite outgrowth inhibitor protein protein rat Rattus norvegicus (Rat) Rat MEDIDQSSLVSSSTDSPPRPPPAFKYQFVTEPEDEEDEEEEEDEEEDDEDLEELEVLERKPAAGLSAAAVPPAAAAPLLDFSSDSVPPAPRGPLPAAPPAAPERQPSWERSPAAPAPSLPPAAAVLPSKLPEDDEPPARPPPPPPAGASPLAEPAAPPSTPAAPKRRGSGSVDETLFALPAASEPVIPSSAEKIMDLMEQPGNTVSSGQEDFPSVLLETAASLPSLSPLSTVSFKEHGYLGNLSAVSSSEGTIEETLNEASKELPERATNPFVNRDLAEFSELEYSEMGSSFKGSPKGESAILVENTKEEVIVRSKDKEDLVCSAALHSPQESPVGKEDRVVSPEKTMDIFNEMQMSVVAPVREEYADFKPFEQAWEVKDTYEGSRDVLAARANVESKVDRKCLEDSLEQKSLGKDSEGRNEDASFPSTPEPVKDSSRAYITCASFTSATESTTANTFPLLEDHTSENKTDEKKIEERKAQIITEKTSPKTSNPFLVAVQDSEADYVTTDTLSKVTEAAVSNMPEGLTPDLVQEACESELNEATGTKIAYETKVDLVQTSEAIQESLYPTAQLCPSFEEAEATPSPVLPDIVMEAPLNSLLPSAGASVVQPSVSPLEAPPPVSYDSIKLEPENPPPYEEAMNVALKALGTKEGIKEPESFNAAVQETEAPYISIACDLIKETKLSTEPSPDFSNYSEIAKFEKSVPEHAELVEDSSPESEPVDLFSDDSIPEVPQTQEEAVMLMKESLTEVSETVAQHKEERLSASPQELGKPYLESFQPNLHSTKDAASNDIPTLTKKEKISLQMEEFNTAIYSNDDLLSSKEDKIKESETFSDSSPIEIIDEFPTFVSAKDDSPKLAKEYTDLEVSDKSEIANIQSGADSLPCLELPCDLSFKNIYPKDEVHVSDEFSENRSSVSKASISPSNVSALEPQTEMGSIVKSKSLTKEAEKKLPSDTEKEDRSLSAVLSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAD DIP protein Q9JK11-1 original sequence version: 97 8CB894B09E94F0B6 q9nqc3-1 Reticulon-4 Nogo-A RTN-xL RTN4 KIAA0886 NOGO Foocen Neurite outgrowth inhibitor Neuroendocrine-specific protein Neuroendocrine-specific protein C homolog RTN-x Reticulon-5 My043 SP1507 RTN4A protein protein human Homo sapiens Human MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSPLSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEMGSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVVSSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKVDKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIFPLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTEEVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSFEESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYEEAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVYSNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEIANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALATQAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE CDE239BBF31589CA yop1_yeast Protein YOP1 YOP1 YIP2 YPR028W YP9367.08 YIP1 partner protein 1 YPT-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH 6F1073444B653CCF 6F1073444B653CCF spg3a-rtn4-1 8 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Mass spectrometry identified reticulon 4a (Rtn4a) as an ATL1-interacting protein. Fig. 1A spg3a-rtn4-2 2 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Mass spectrometry identified reticulon 4a (Rtn4a) as an ATL1-interacting protein. Fig. 1A spg3a-rtn4-3 3 9 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association To confirm the interaction of ATL1 and Rtn4a, we incubated brain or spinal cord extracts with ATL1 antibodies, and we resolved precipitated proteins by SDS-PAGE. Immunoblot analysis demonstrated that Rtn4a was coprecipitated (Figure 1B, lanes 4 and 6; nonimmune IgG controls are shown in lanes 3 and 5), Fig. 1B spg3a-rtn4-4 4 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association To confirm the interaction of ATL1 and Rtn4a, we incubated brain or spinal cord extracts with ATL1 antibodies, and we resolved precipitated proteins by SDS-PAGE. Immunoblot analysis demonstrated that Rtn4a was coprecipitated (Figure 1B, lanes 4 and 6; nonimmune IgG controls are shown in lanes 3 and 5), Fig. 1B spg3a-rtn4-5 3 18 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Conversely, antibodies to Rtn4a coprecipitated ATL1 (Figure 1C, lanes 4 and 6; controls in lanes 3 and 5). Fig. 1C spg3a-rtn4-6 4 18 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Conversely, antibodies to Rtn4a coprecipitated ATL1 (Figure 1C, lanes 4 and 6; controls in lanes 3 and 5). Fig. 1C spg3a-rtn4-7 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To test whether ATL1 also interacts with other tubule-shaping proteins, we performed cotransfection experiments. Myc-tagged ATL1 (Myc-ATL1) and hemagglutinin (HA)-tagged reticulon 3c (HA-Rtn3c) were expressed either individually or together in COS-7 cells, and cell extracts were subjected to immunoprecipitation. Fig. 2A spg3a-rtn4-8 1 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To test whether ATL1 also interacts with other tubule-shaping proteins, we performed cotransfection experiments. Myc-tagged ATL1 (Myc-ATL1) and hemagglutinin (HA)-tagged reticulon 3c (HA-Rtn3c) were expressed either individually or together in COS-7 cells, and cell extracts were subjected to immunoprecipitation. Fig. 2A spg3a-reep5-1 1 17 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Similar experiments demonstrated that ATL1 also interacts with DP1, a member of the other tubule-shaping protein family Fig. 2A spg3a-reep5-2 1 17 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Similar experiments demonstrated that ATL1 also interacts with DP1, a member of the other tubule-shaping protein family Fig. 2A spg3a-rtn4-9 1 19 unspecified role unspecified role prey prey reticulon region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Indeed, when the cytoplasmic N terminus was deleted from Rtn4a, leaving only the reticulon homology domain (Rtn4HD), the interaction with ATL1 was maintained (Figure 2C, lanes 3 and 5). Fig. 2C Exact coordinates of the reticulon homology domain could not be traced so have been taken from the UniProtKB entry. spg3a-rtn4-10 1 19 unspecified role unspecified role bait bait reticulon region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Indeed, when the cytoplasmic N terminus was deleted from Rtn4a, leaving only the reticulon homology domain (Rtn4HD), the interaction with ATL1 was maintained (Figure 2C, lanes 3 and 5). Fig. 2C Exact coordinates of the reticulon homology domain could not be traced so have been taken from the UniProtKB entry. spg3a-rtn3-1 1 14 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey transmembrane region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Indeed, when the cytoplasmic N terminus was deleted from Rtn4a, leaving only the reticulon homology domain (Rtn4HD), the interaction with ATL1 was maintained (Figure 2C, lanes 3 and 5). Fig. 2E, Supp. Fig. 2A Exact coordinates of the TM (transmembrane + C-terminal) domain could not be traced so have been taken from the UniProtKB entry. yop1-sey1-1 7 20 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association When HA-Sey1p was precipitated with HA antibodies, Yop1p-FLAG was coprecipitated (Figure 6D, lane 24). Fig. 6D yop1-sey1-2 7 20 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association When HA-Sey1p was precipitated with HA antibodies, Yop1p-FLAG was coprecipitated (Figure 6D, lane 24). Fig. 6D rtn1-sey1-1 7 15 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Similar results were obtained when the interaction of HA-Sey1p and Rtn1p-Myc was tested in a strain lacking endogenous Sey1p and Rtn1p (Figure 6E, lanes 11 and 19) Fig. 6E rtn1-sey1-2 7 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Similar results were obtained when the interaction of HA-Sey1p and Rtn1p-Myc was tested in a strain lacking endogenous Sey1p and Rtn1p (Figure 6E, lanes 11 and 19) Fig. 6E spg3a-rtn3-2 1 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. Fig. 2A atl2-rtn3-1 1 14 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3A and 4A Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-rtn3-2 1 14 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3A and 4A Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-reep5-1 1 12 unspecified role unspecified role prey prey region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3B and 4B Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. atl2-reep5-2 1 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region Transmembrane + C-terminal domain sufficient to bind sufficient binding region sufficient to bind range range range range region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3B and 4B Coordinates of the Transmembrane + C-terminal domain of Q8NHH9 not supplied in the paper so have been inferred from the UniProtKB entry. spg3a-rtn3-3 6 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8WXF7:p.Lys80Ala GTP-binding mutant mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:09:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys80ala' Tue Jun 30 20:13:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys80Ala' 14 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Supp. Fig. 10 Co-localization of a GTP-binding mutant of ATL1 with Rtn3c. sey1-gtp 5 16 enzyme target enzyme target substrate substrate neutral component neutral component 13 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99287:p.Lys50Ala Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:25:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys50ala' Tue Jun 30 18:25:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys50Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction GTPase activity of the cytoplasmic domain of the Sey1p K50A mutant. Sup. Fig. 15