IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cell (0092-8674) 2009 imex curation Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Accepted 2009-SEP-18 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 9 imex curation Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cell (0092-8674) 2009 imex curation Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 9 imex curation Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cell (0092-8674) 2009 imex curation Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-bone-marrow Mouse bone marrow bone_marrow bone marrow anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 9 imex curation cdk2_mouse Cyclin-dependent kinase 2 Cdk2 Cell division protein kinase 2 Cdkn2 protein protein mouse Mus musculus Mouse MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL DIP protein P97377 original sequence version: 140 D806BC2F150AEDFC ccne1_mouse G1/S-specific cyclin-E1 Ccne1 Ccne protein protein mouse Mus musculus Mouse MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE DIP protein Q61457 original sequence version: 110 4916B5D7117ADA69 cdk1_mouse Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 Cdk1 Cdc2a Cdc2 Cell division control protein 2 homolog Cdkn1 protein protein mouse Mus musculus Mouse MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM DIP protein P11440 original sequence version: 149 DIP protein P11440 original sequence version: 164 9C399FCC41BA7F31 ccna2_mouse Cyclin-A2 Ccna2 Ccna Cyca Cyca2 protein protein mouse Mus musculus Mouse MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV DIP protein P51943 original sequence version: 86 1818B92552E4D0D1 cdk2-ccna2-1 1 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 7E cdk2-ccne1-5 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 7E, 7G Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk2-ccna2-2 3 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 7E The Cyclin A2 observed in this interaction is described as a shorter (38kDa) form than normally observed but this isoform is not present in UniProtKB. cdk2-ccne1-6 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 7E, 7G Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk2-ccna2-3 2 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 7E Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk1-ccne1-1 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 7G Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk1-ccne1-2 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 7G Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk1-ccna2-1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 7E Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts cdk1-ccna2-2 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 7E Immunoprecipitation of Cdk1 or Cdk2 followed by immunoblotting with anti-cyclin A2 antibodies indicated that cyclin A2-Cdk1 and A2-Cdk2 complexes are substantially more abundant in ESCs than in fibroblasts