UniProt UniProt http://www.uniprot.org Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. J. Biol. Chem. (0021-9258) 2009 imex curation Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu Accepted 2013-JAN-08 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. J. Biol. Chem. (0021-9258) 2009 imex curation Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu Accepted 2013-JAN-08 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. J. Biol. Chem. (0021-9258) 2009 imex curation Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu Accepted 2013-JAN-08 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation ppif_rat Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein rat Rattus norvegicus (Rat) Rat MLALRCGPRLLGLLSGPRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS 69048482631B9FAD bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bcl2_rat Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein rat Rattus norvegicus (Rat) Rat MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P49950 original sequence version: 87 E7688CB9071A872A ppif_human Peptidyl-prolyl cis-trans isomerase F, mitochondrial PPIF CYP3 Cyclophilin F Rotamase F Cyclophilin D Mitochondrial cyclophilin protein protein human Homo sapiens Human MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS D7C76F1D4049F16A bcl2-ppif 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1A, 2B, 2D cyclosporin A Calcium has no effect on the association bcl2-ppif-1 2 5 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep rat-liver rattus norvegicus liver Rat liver liver Mitochondrial protein extracts have been used. physical association physical association 1B, 2C, 2E Calcium had no affect on the pull-down. Cyclosporine A bcl2-ppif-2 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1D