IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Plant J. (0960-7412) 2008 imex curation Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. orchard Only protein-protein interactions allce Allium cepa (Onion) Onion fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Accepted 2009-MAY-15 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Plant J. (0960-7412) 2008 imex curation Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. orchard Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Accepted 2009-MAY-15 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Plant J. (0960-7412) 2008 imex curation Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Accepted 2009-MAY-15 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Plant J. (0960-7412) 2008 imex curation Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Accepted 2009-MAY-15 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. Plant J. (0960-7412) 2008 imex curation Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. orchard Only protein-protein interactions allce Allium cepa (Onion) Onion confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Accepted 2009-MAY-15 by ORCHARD. 01-Sep-2009: Contacted by JYOTI. Arabidopsis cDNA library. Plant J. (0960-7412) 2008 orchard Only protein-protein interactions imex curation cyb5a_arath Cytochrome b5 isoform A CB5-D Cytochrome b5 isoform D F28B23.1 T1K7.28 At1g26340 CB5-A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTLTKLYSMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDARELMEKYFIGELDESSLPEIPELKIYKKDQPQDSVQKLFDLTKQYWVVPVSIITISVAVSVLFSRKT F88FCB6B5BBC8E9E cyb5b_arath Cytochrome b5 isoform B CYTB5-B CB5-E Cytochrome b5 isoform 2 Cytochrome b5 isoform E F24L7.14 At2g32720 CB5-B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTKSG B405F5430F5716C1 fah2_arath Dihydroceramide fatty acyl 2-hydroxylase FAH2 FAH2 Fatty acid 2-hydroxylase 2 T13K14.30 At4g20870 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAERYTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFESDFWEFLTRTVWWAIPTIWLPVVCYVLSISASKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKSYWANTAHYLLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPAILGGILFGYVMYDITHYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFGTLPGIKAAAKKS B89B31208E5AE87C cyb5e_arath Cytochrome b5 isoform E CYTB5-E B5-A CB5-A CB5-E Cytochrome b5 isoform 1 Cytochrome b5 isoform A MNC6.10 At5g53560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD 9CC01C60F7C873FD cyb5c_arath Cytochrome B5 isoform C CYTB5-C CB5-C T3A4.3 At2g46650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANLISFHDVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDNVLLAVTGKDASIDFEDVNHSKDAKELMKKYCIGDVDQSTVPVTQQYIPPWEKESTAAETTKEESGKKLLIYLIPLLILGVAFALRFYNNK 894A1133E88596BC cyb5d_arath Cytochrome B5 isoform D CYTB5-D B5-B CB5-B CB5-D Cytochrome b5 isoform B K24G6.14 At5g48810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAFGIRYYTKTKAPSS 18C24FF8F7995E08 fah1_arath Dihydroceramide fatty acyl 2-hydroxylase FAH1 FAH1 Fatty acid 2-hydroxylase 1 T29F13.2 At2g34770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPVIWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHYLIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGTLPTTKAPRKEQ 9EF58769FEBCA5C7 bi1_arath Bax inhibitor 1 BI-1 K14A3.7 At5g47120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN FD3AAEA713363945 bl_1-cb5b 4 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association To investigate the molecular function of AtBI-1, we attempted to identify its interactors. When we screened the Arabidopsis cDNA library with the split-ubiquitin yeast two hybrid (suY2H) system, AtCb5 (At2g32720) was isolated as a candidate for interaction. Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. bl_1-cb5b-1 3 7 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait physical association physical association To further ascertain the interaction between AtBI-1 and AtCb5, we divided AtCb5-B into an N-terminal cytosolic region (AtCb5-BN; 1�106 aa) and a C-terminal transmembrane-tail region (AtCb5-BC; 107�134 aa), and tested the interaction with AtBI-1 (Figure 2c). As demonstrated in Figure 2d, it was seen that AtBI-1 interacted only with AtCb5-BN, suggesting that AtBI-1 interacts with AtCb5 on the cytosolic side of the ER. Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2d bl_1-cb5a 3 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association As shown in Figure 2b, all AtCb5s interacted with AtBI-1, Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5c 3 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association To investigate the molecular function of AtBI-1, we attempted to identify its interactors. When we screened the Arabidopsis cDNA library with the split-ubiquitin yeast two hybrid (suY2H) system, AtCb5 (At2g32720) was isolated as a candidate for interaction. Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5d 3 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association To investigate the molecular function of AtBI-1, we attempted to identify its interactors. When we screened the Arabidopsis cDNA library with the split-ubiquitin yeast two hybrid (suY2H) system, AtCb5 (At2g32720) was isolated as a candidate for interaction. Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5e 3 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association To investigate the molecular function of AtBI-1, we attempted to identify its interactors. When we screened the Arabidopsis cDNA library with the split-ubiquitin yeast two hybrid (suY2H) system, AtCb5 (At2g32720) was isolated as a candidate for interaction. Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5b-2 2 13 unspecified role unspecified role neutral component neutral component c-terminal C terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association AtBI-1 interacts with AtCb5-B in plant cells. Figure 3a to Figure 3g inclusive bl_1-cb5b-3 5 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization AtBI-1 interacts with AtCb5-B in plant cells. Figure 3h bl_1-cb5b-4 1 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction AtBI-1 interacts with AtCb5-B in plant cells. Figure 3j fah1-cb5b 3 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Interactions between AtCb5-B and AtFAH1 or AtFAH2 were detected by the split-ubiquitin yeast two-hybrid (suY2H) system. Figure 6b fah2-cb5b 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Interactions between AtCb5-B and AtFAH1 or AtFAH2 were detected by the split-ubiquitin yeast two-hybrid (suY2H) system. Figure 6b fah2-cb5b-5 5 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization AtFAH2 interacts with AtCb5-B in plant cells. Figure 7a fah2-cb5b-6 1 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Fluorescence resonance energy transfer (FRET) analysis of the interaction between AtFAH2-CFP and YFP-AtCb5-B Figure 7c