IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard mouse-bone-marrow Mouse bone marrow bone_marrow bone marrow fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus confocal microscopy confocal microscopy immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis no One interaction subsequently shown to be indirect so no-uniprot export added to entry. Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. Cell. Mol. Life Sci. (1420-682X) 2009 Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu 23-Feb-2010: Contacted by JYOTI. Human testis cDNA orchard human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Linear 5-20%sucrose density gradient. Additional detail of constructs supplied by the author. Montenarh@uks.eu Accepted 2009-Not a month!-4 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 orchard csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR DIP protein P67870 original sequence version: 77 DIP protein P67870 original sequence version: 124 DIP protein P67870 original sequence version: 134 E465B1E699B0E0EC ck2_substrate Sequence:RRRDDDSDDD protein protein chemical synthesis Chemical synthesis (Chemical synthesis) RRRDDDSDDD An amino acid sequence which is not represented in UniProt 777730B5BAAAAAB4 kif5c_mouse Kinesin heavy chain isoform 5C Kif5c Nkhc2 Kinesin heavy chain neuron-specific 2 protein protein mouse Mus musculus Mouse MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVLQHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNITPVVDGISAEKEKYDEEITSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRLRDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK A36BC903603D8748 csk22_human Casein kinase II subunit alpha' CSNK2A2 CK2A2 protein protein human Homo sapiens Human MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR DIP protein P19784 original sequence version: 157 DIP protein P19784 original sequence version: 168 3ECB92F6BD3DD7F1 csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D csk22_mouse Casein kinase II subunit alpha' Csnk2a2 protein protein mouse Mus musculus Mouse MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR C5FA314617627F5B csk21_mouse Casein kinase II subunit alpha Csnk2a1 Ckiia protein protein mouse Mus musculus Mouse MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ DIP protein Q60737 original sequence version: 82 DIP protein Q60737 original sequence version: 146 C7A5F7CC8099230D kif5c_human Kinesin heavy chain isoform 5C Kinesin heavy chain neuron-specific 2 KIF5C KIAA0531 NKHC2 protein protein human Homo sapiens Human MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK A9F25BB1C994322A csnk2a2-csnk2b-1 9 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Table 1. csnk2a1-kif5c-3 9 15 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1. csnk2a2-kif5c-1 9 18 unspecified role unspecified role prey prey n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait physical association physical association Table 1. csnk2a1-kif5c-6 5 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association CSNK2A1 binds to the to nucleotides 762-1047 of KIF5C. Fig 1. csnk2a2-kif5c-2 5 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association this is the ck2 alpha nd ck2beta interaction Fig 1. csnk2a1-kif5c-1 10 18 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association Fig 3A csnk2a2-ck2_subst 1 18 competitor competitor competitor neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 12 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 14 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation Fig 7. Figure legend was previously entered as Fig 5B, for some reason. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2a1-ck2_subst-1 1 18 competitor competitor competitor neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 12 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 15 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation Fig 7. Figure legend was originally added as "Fig 3B" for some reason. I have altered this to Fig 7. There are now 3 ck2_substrates here!!: one you originally added (EBI-2504918 ), but I have modified this entry (as in EBI-2526492) to give the precise substrate as used in the second assay on page 345 Fig7. However, this is a "small molecule" - wheras you added a protein. So I added a 3rd entry (EBI-2526569) as a "protein" but the sequence is not visible so I added this to the "full name" so it can be seen. Please can you remove whichever entry is incorrect - I dont want to remove the first entry in case I "lose" the info forever... Should 32P be added in this way? - or added at all? Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2b-kif5c 6 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. csnk2a1-kif5c-8 6 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. csnk2a2-kif5c-9 6 14 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. kif5c-csnk2a2-2 7 14 unspecified role unspecified role prey prey human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells direct interaction direct interaction Fig 5. kif5c-csnk2a2 8 14 unspecified role unspecified role prey prey human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 6. kif5c-csnk2a2-1 3 18 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization All three CK2 subunits in the cytoplasm co-localized, at least in part, with KIF5C. Fig 8. kif5c-csnk2a1-2 3 15 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization All three CK2 subunits in the cytoplasm co-localized, at least in part, with KIF5C. Fig 8. kif5c-csnk2b 3 18 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization All three CK2 subunits in the cytoplasm co-localized, at least in part, with KIF5C. Fig 8. kif5c-csnk2a1 2 13 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 9. kif5c-csnk2a2-3 2 13 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 9. csnk2a1-kif5c-12 4 17 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 10. csnk2a2-kif5c-13 4 16 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization Merging of signals showed cytoplasmic co-localisation of mainly Casein kinase II subunit alpha' and KIF5C. Fig 10. csk2a1-csk2b 9 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Table 1. csnk2a2-ck2_subst-1 1 14 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells 12 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation Fig 7. Figure legend was previously entered as Fig 5B, for some reason. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2a1-ck2_subst-2 1 12 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 15 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation Fig 7. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1).