IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Novel cardiac apoptotic pathway: the dephosphorylation of apoptosis repressor with caspase recruitment domain by calcineurin. Novel cardiac apoptotic pathway: the dephosphorylation of apoptosis repressor with caspase recruitment domain by calcineurin. Circulation (0009-7322) 2008 imex curation Tan W.Q., Wang J.X., Lin Z.Q., Li Y.R., Lin Y., Li P.F. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions involving ARC (phosphorylation assay and co-inmunoprecipitation) were not included because the precise origin of the protein was not stated in the paper. peifli@ioz.ac.cn 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tan W.Q., Wang J.X., Lin Z.Q., Li Y.R., Lin Y., Li P.F. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions involving ARC (phosphorylation assay and co-inmunoprecipitation) were not included because the precise origin of the protein was not stated in the paper. peifli@ioz.ac.cn Accepted 2011-OCT-24 by ORCHARD Circulation (0009-7322) 2008 Only protein-protein interactions imex curation tnr6_rat Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor protein protein rat Rattus norvegicus (Rat) Rat MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENSISNSRNENEGQSLE D25D583C909D9D09 casp8_rat Caspase-8 Casp8 protein protein rat Rattus norvegicus (Rat) Rat MDFHSCLYDIAERLGNEELAALKFLCLDHIPQKKQESINDVLVLFQRLQEEGMLEEDNLSFLKELLFHISRRDLLSRVLKSSPEEMVRELQVLGKAQVSAYRVMLFKLSEDMDKEDLKSFKFLLITEIPKCKLQDNSSLLDIFVEMEKRTILAENNLVTLKSICFRVNRSLLGRIDDYERSSTERRMSTEGGEELPVSVLDEVTIKMQDMWDSPGEQESESLNSDNVYQMKSKPRGYCLIFNNNNFSKAREDIPKLSNMRDRKGTNYDEEALSKTFKELHFEIVSFSDCTASQIHEVLVSYQSKDHKGKDCFICCILSHGDKGIVYGTDGKEASIYELTSYFTGSKCPSLAGKPKIFFIQACQGNNFQKAVPVPDETGLEQEHVLEEDSSSYKNYIPDEADFLLGMATVKNCVSYRDPTRGTWYIQSLCQSLRERCPRGEDILSILTGVNYDVSNKDNPRNMGKQMPQPIFTLRKKLFFPPN 82B4A29330C53264 q8r2e7_rat FAS-associated death domain protein rCG_48606 Fadd fadd FAS-associating death domain-containing protein protein protein rat Rattus norvegicus (Rat) Rat MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHTGLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELKVSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEALMAQGSVSKSDDTSSALRDSTVSFSETP ABA3305406137CDB nol3_rat Nucleolar protein 3 Nol3 Arc Apoptosis repressor with CARD protein protein rat Rattus norvegicus (Rat) Rat MGNMQERPSETIDRERKRLVETLQADSGLLLDALVARGVLTGPEYEALDALPDAERRVRRLLLLVQSKGEAACQELLRCAQQTVSMPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPSSGTTCPGLPRASEEEEIGGPEDSEAVQPRTPEEPELEAEATKGDEPDLEQEMEPEPEPEVEPEPEPEPEPEPEPEPEPEPEPEPEREPDFQEGDESEGCENT A7661C9040B2CD4D casp8-fadd-10 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 6d Isoprotenerol was required for this endogenous interaction to happen. nol3 over expression disrupted the interaction. fadd-casp8-9 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey association association 6d Isoprotenerol was required for this endogenous interaction to happen. nol3 over expression decreased the interaction. casp8-nol3 1 5 unspecified role unspecified role prey prey Q62881:p.Thr149Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D Wed May 02 16:56:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr149asp' Tue Jun 30 19:13:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr149Asp' The phosphorylated form of nol3 was also detected in this experiment. 3 unspecified role unspecified role bait bait physical association physical association 6d 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole (DRB) inhibited the interaction.