UniProt UniProt http://www.uniprot.org p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX and myc-CDKN2A/ARF. james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX, myc-CDKN2A/ARF and HDM2 plasmids. james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis COS-7 cells have been transfected with FLAG-DAXX and myc-CDKN2A/ARF. james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX, myc-CDKN2A/ARF and HDM2 plasmids. james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis COS-7 cells have been transfected with FLAG-DAXX and cell lysates have been incubated with GST-CDKN2A/ARF. james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation p14ARF interacts with DAXX: effects on HDM2 and p53. p14ARF interacts with DAXX: effects on HDM2 and p53. Cell Cycle (1538-4101) 2008 imex curation Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library jyoti Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca Accepted 2008-OCT-22 by JYOTI. human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 jyoti Only protein-protein interactions imex curation daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 arf_human Tumor suppressor ARF p14ARF CDKN2A CDKN2 MLM Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein human Homo sapiens Human MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG DIP protein Q8N726 original sequence version: 97 DIP protein Q8N726 original sequence version: 113 DIP protein Q8N726 original sequence version: 72 7739A9050C21BC96 mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP DIP protein Q00987 original sequence version: 93 DIP protein Q00987-1 original sequence version: 192 DIP protein Q00987 original sequence version: 88 DIP protein Q00987 original sequence version: 180 DIP protein Q00987 original sequence version: 188 DIP protein Q00987 original sequence version: 189 DIP protein Q00987 original sequence version: 115 DIP protein Q00987-1 original sequence version: null DIP protein Q00987 original sequence version: 149 DIP protein Q00987 original sequence version: 146 DIP protein Q00987 original sequence version: 140 DIP protein Q00987 original sequence version: 183 DIP protein Q00987 original sequence version: 145 DIP protein Q00987 original sequence version: 182 DIP protein Q00987 original sequence version: 151 DIP protein Q00987 original sequence version: 156 DIP protein Q00987-1 original sequence version: 160 DIP protein Q00987 original sequence version: 160 DIP protein Q00987 original sequence version: 168 DIP protein Q00987 original sequence version: 186 DIP protein Q00987 original sequence version: 206 F37CE163876BC983 cdkn2a-daxx 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association no figure cdkn2a-daxx-1 6 10 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 1A daxx-cdkn2a 4 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association 1B and 4 cdkn2a-daxx-3 4 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association 1B cdkn2a-daxx-4 1 10 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 9 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference colocalization colocalization 2 daxx-cdkn2a-1 7 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 3B cdkn2a-daxx-6 7 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 3A cdkn2a-daxx-7 8 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 3C daxx-mdm2-5 2 11 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association 5A mdm2-cdkn2a-1 5 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 11 unspecified role unspecified role bait bait human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association 5C