IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Tagged participants may be identified by an anti-tag western. gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 human-kb Homo sapiens oral epithelial carcinoma kb Human oral epithelial carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. Cell (0092-8674) 2008 imex curation Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA davet Only protein-protein interactions 21 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca Accepted 2008-AUG-11 by DAVET. 27-Aug-2008: Contacted by JYOTI. HeLa cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 21 imex curation sc61b_human Protein transport protein Sec61 subunit beta SEC61B protein protein human Homo sapiens Human MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS DIP protein P60468 original sequence version: 100 DIP protein P60468 original sequence version: 80 DIP protein P60468 original sequence version: 77 5FAFF4197A62FA49 cftr_human Cystic fibrosis transmembrane conductance regulator CFTR ABCC7 cAMP-dependent chloride channel ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase protein protein human Homo sapiens Human MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL 8D082AA2E768C065 rnf5_human E3 ubiquitin-protein ligase RNF5 RNF5 G16 RING finger protein 5 Protein G16 NG2 RMA1 Ram1 homolog RING-type E3 ubiquitin transferase RNF5 protein protein human Homo sapiens Human MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI DIP protein Q99942 original sequence version: 56 DIP protein Q99942 original sequence version: 91 E5AFA4DE6DE85942 bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE D34367F870D6EB00 tram1_human Translocating chain-associated membrane protein 1 TRAM1 TRAM protein protein human Homo sapiens Human MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS 9232ADA33DE20076 derl1_human Derlin-1 DERL1 UNQ243/PRO276 Der1-like protein 1 Degradation in endoplasmic reticulum protein 1 DER1 protein protein human Homo sapiens Human MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ 4A6E0DB68D9AF244 a5x380_mesau B-cell receptor-associated protein Bcap31 BAP31 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MSVQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIIILVLLVIDAAREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKEAAEDGAKLDVGNTEVKLEENKTLKNDLKKLKDELANTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVHGPSAKKEE C320702902419FAA derl1_mesau_protein Derlin-1 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster An amino acid sequence which is not represented in UniProt Similar to Q9BUN8 sc61b_mesau Protein transport protein Sec61 subunit beta protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster An amino acid sequence which is not represented in UniProt Similar to P60468 bcap31-sec61b-1 2 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Utilizing BAP31 as bait in the split-ubiquitin yeast 2-hybrid screen to detect interactions between membrane-associated proteins, two constituents of the Sec61 preprotein translocon, Sec61β and TRAM, exhibited the highest hit rate. bcap31-tram1-1 2 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Utilizing BAP31 as bait in the split-ubiquitin yeast 2-hybrid screen to detect interactions between membrane-associated proteins, two constituents of the Sec61 preprotein translocon, Sec61β and TRAM, exhibited the highest hit rate. bcap31-sec61b-2 10 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Associations between BAP31 and either Sec61β (Figure 1C, left) or TRAM (Figure 1C, right) were likewise demonstrated by transient cotransfection of vectors expressing the epitope-tagged proteins in Cos1 cells, followed by immunoprecipitation of either the BAP31 protein or the Sec61β and TRAM proteins. Fig. 1C bcap31-sec61b-3 10 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Associations between BAP31 and either Sec61β (Figure 1C, left) or TRAM (Figure 1C, right) were likewise demonstrated by transient cotransfection of vectors expressing the epitope-tagged proteins in Cos1 cells, followed by immunoprecipitation of either the BAP31 protein or the Sec61β and TRAM proteins. Fig. 1C bcap31-tram1-2 10 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Associations between BAP31 and either Sec61β (Figure 1C, left) or TRAM (Figure 1C, right) were likewise demonstrated by transient cotransfection of vectors expressing the epitope-tagged proteins in Cos1 cells, followed by immunoprecipitation of either the BAP31 protein or the Sec61β and TRAM proteins. Fig. 1C bcap31-tram1-3 10 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Associations between BAP31 and either Sec61β (Figure 1C, left) or TRAM (Figure 1C, right) were likewise demonstrated by transient cotransfection of vectors expressing the epitope-tagged proteins in Cos1 cells, followed by immunoprecipitation of either the BAP31 protein or the Sec61β and TRAM proteins. Figs. 1C & 1E bcap31-sec61b-4 4 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Endogenous BAP31 and Sec61β were coimmunoprecipitated from both HeLa and KB cells Fig. 1D bcap31-sec61b-5 8 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Endogenous BAP31 and Sec61β were coimmunoprecipitated from both HeLa and KB cells Fig. 1D bcap31-sec61b-6 6 12 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain F . Wed May 02 15:45:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 18:10:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association The associations between endogenous BAP31, Sec61β, and CFTR were monitored by immunoblotting of anti-BAP31 immunoprecipitates, Fig. 2A P13569 transfection bcap31-sec61b-7 4 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than 11 unspecified role unspecified role bait bait physical association physical association Anti-Sec61β immunoprecipitates were analyzed by immunoblotting with anti-BAP31 (top panel) Figs. 5A and 7A BCAP31 has two potential caspase-8 cleavage sites and it is impossible to determine which generates the p20 construct from the information given. P51572 transfection Complex also bound Sec61a but it was impossible to determine whether this was SEC61A1 or SEC61A2 bcap31-tram1-4 4 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interactions between TRAM and p20BAP31 were monitored in cotransfected cells as indicated. Fig. 5B BCAP31 has two potential caspase-8 cleavage sites and it is impossible to determine which generates the p20 construct from the information given. Q15629; P51572 transfection bcap31-derl1-1 1 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association The ability of BAP31 to associate with Derlin1 and RMA1 was monitored by immunoblotting of anti-Flag immunoprecipitates with antibodies against HA or anti-BAP31. Fig. 6A bcap31-cftr-1 3 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain F . Wed May 02 16:57:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 16:16:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' physical association physical association The association of BAP31 with CFTRΔF508 was monitored by immunoblotting of anti-BAP31 immunoprecipitates with antibody against CFTR. Fig. 6G Cells were treated with DERL1 siRNA, resulting in an elevation of CFTRΔF508 levels bcap31-derl1-2 3 14 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Fig. 6G Cells were treated with DERL1 siRNA, resulting in an elevation of CFTRΔF508 levels bcap31-cftr-2 9 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined membrane spanning sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait physical association physical association BAP31 associates with the MSD1 domain of CFTR Fig. 7C bcap31-tram1-5 7 15 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization BAP31 colocalizes with TRAM Supp. Fig. 2 bcap31-sec61b-8 7 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization BAP31 colocalizes with TRAM and Sec61β. Supp. Fig. 2 bcap31-cftr-3 5 14 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization A significant fraction of CFTR colocalizes with BAP31 in the ER. Supp. Fig. 3 bcap31-derl1-3 3 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 8 Endogenous Derlin-1 associates with endogenous BAP31. derl1-sec61b-1 6 18 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain F . Wed May 02 20:25:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 20:15:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' physical association physical association Supp. Fig. 9 P13569 transfection derl1-sec61b-2 6 12 unspecified role unspecified role bait bait P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain F . Wed May 02 15:59:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe508del' Tue Jun 30 19:44:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe508del' 18 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 9 P13569 transfection