IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. Cancer Cell (1535-6108) 2008 imex curation Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 1 human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu Accepted 2008-JUN-16 by DAVET. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 1 imex curation Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. Cancer Cell (1535-6108) 2008 imex curation Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 1 human-ln_229 Homo sapiens malignant glioma cell line LN-229 ln_229 Human malignant glioma cell line LN-229 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of CDKN2C was taken from PMID 9528803. (The donor of the construct is an author of this paper). cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu Accepted 2008-JUN-16 by DAVET. 25-Jun-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 1 imex curation cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA 571733EE6BE7FD4A cdn2c_human_gene Human CDKN2C (p18-INK4C) gene gene human Homo sapiens Human cdn2c_human Cyclin-dependent kinase 4 inhibitor C CDKN2C CDKN6 p18-INK4c Cyclin-dependent kinase 6 inhibitor p18-INK6 protein protein human Homo sapiens Human MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ 5D66AFA715186E9A e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF DIP protein Q01094 original sequence version: 173 DIP protein Q01094 original sequence version: 168 DIP protein Q01094 original sequence version: 149 DIP protein Q01094 original sequence version: 130 DIP protein Q01094 original sequence version: 125 DIP protein Q01094 original sequence version: 153 DIP protein Q01094 original sequence version: 180 003B3F654F0C60DF e2f1-cdkn2c 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association 2 A the activating E2F1 transcription factor was indeed bound physically to the p18INK4C promoter cdk-cdkn2c 2 5 unspecified role unspecified role prey prey P42773:p.Phe37Ile mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F I Wed May 02 18:57:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37ile' Tue Jun 30 15:40:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Ile' P42773:p.Ala61Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A D Wed May 02 20:22:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala61asp' Tue Jun 30 20:09:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala61Asp' 3 unspecified role unspecified role bait bait physical association physical association 3 D Wild-type, but not mutant, p18INK4C coimmunoprecipitated with CDK6 P42773 infection This interaction is curated with the only form of CDKN2C (p18-INK4C) available in the UniProtKB entry.