IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Cancer Cell (1535-6108) 2008 imex curation Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de 14-May-2008: Contacted by JYOTI. orchard Only protein-protein interactions 8 human-ln18 Homo sapiens LN18 glioblastoma cell line ln18 LN18 human glioblastoma cell line The LN-18 cell line was established in 1976 from cells taken from a patient with a right temporal lobe glioma. The cells are poorly differentiated. The cells are negative for glial fibrillary acidic proteins and S100 (S-100) protein. The cells exhibit mutated p53 (TP53) and possible homozygous deletions in the p16 and p14ARF tumor suppressor genes. They have a wild-type PTEN gene. Stimulation of the cells with Fas ligand lead to apoptotic cell death within 16 hours. The cells were also killed by puromycin in a dose dependent manner. Bcl-2 protects these cells from Fas ligand-induced cell death but was shown to have only a small protective effect on puromycin-induced apoptosis. This cell line is used in studies on apoptosis. (Source of this information is the ATCC entry). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Accepted 2008-MAY-14 by ORCHARD. 14-May-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 orchard Only protein-protein interactions 8 imex curation Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Cancer Cell (1535-6108) 2008 imex curation Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de 14-May-2008: Contacted by JYOTI. orchard Only protein-protein interactions 8 human-t98g Human caucasian glioblastoma line T98G t98g Human Caucasian glioblastoma T98G anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Accepted 2008-MAY-14 by ORCHARD. 14-May-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 orchard Only protein-protein interactions 8 imex curation Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. Cancer Cell (1535-6108) 2008 imex curation Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de 14-May-2008: Contacted by JYOTI. orchard Only protein-protein interactions 8 human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Accepted 2008-MAY-14 by ORCHARD. 14-May-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 orchard Only protein-protein interactions 8 imex curation yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL DIP protein P07947 original sequence version: 131 DIP protein P07947 original sequence version: 148 DIP protein P07947 original sequence version: 140 A2B376084686BBCD fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P12931 original sequence version: 188 DIP protein P12931 original sequence version: 189 DIP protein P12931 original sequence version: 190 DIP protein P12931 original sequence version: 191 DIP protein P12931 original sequence version: 115 DIP protein P12931 original sequence version: 116 DIP protein P12931 original sequence version: 164 DIP protein P12931 original sequence version: 142 DIP protein P12931 original sequence version: 143 DIP protein P12931 original sequence version: 150 DIP protein P12931 original sequence version: 160 DIP protein P12931 original sequence version: 184 DIP protein P12931 original sequence version: 155 DIP protein P12931-1 original sequence version: 155 DIP protein P12931 original sequence version: 202 C1908084683E5DE8 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 fas-yes1 2 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 4 C we identified Yes as the Src family member that links CD95 to PI3K fas-src 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4 A CD95L-T4 - Src association decreased at higher concentrations of CD95L-T4. fas-fadd 1 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction. Whereas upon stimulation with CD95L-T4 recruitment of FADD to CD95 increased in LN18 cells, no increase was detected in T98G cells fas-fadd-1 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 5 D, 5 E Whereas upon stimulation with CD95L-T4 recruitment of FADD to CD95 increased in LN18 cells, no increase was detected in T98G cells casp8-fas-1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction. Caspase-8 recruitment to CD95 increased upon stimulation with CD95L-T4 in LN18 and J16 cells but not in T98G cells casp8-fas 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 5 D Caspase-8 recruitment to CD95 increased upon stimulation with CD95L-T4 in LN18 and J16 cells but not in T98G cells casp8-fas-2 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction. Caspase-8 recruitment to CD95 increased upon stimulation with CD95L-T4 in LN18 and J16 cells but not in T98G cells fas-src-1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4 B CD95L-T4 - Src association decreased at higher concentrations of CD95L-T4.